DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17187 and Dnajc30

DIOPT Version :9

Sequence 1:NP_650056.1 Gene:CG17187 / 41351 FlyBaseID:FBgn0037882 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_001102494.1 Gene:Dnajc30 / 368190 RGDID:1595783 Length:219 Species:Rattus norvegicus


Alignment Length:175 Identity:47/175 - (26%)
Similarity:78/175 - (44%) Gaps:36/175 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KKYSDVNLYDLLGISLESDQNEIRKAYRKKALECHPDKNPDNPKAVERFHELSKALEILTDESAR 68
            :.||...||||||:...:.|.:|:.||.:::...|||:||.:.:|.|||..:|:|..:|.....|
  Rat    36 RTYSRNALYDLLGVPSTATQAQIKAAYYRQSFLYHPDRNPGSTEAAERFTRISEAYLVLGSTILR 100

  Fly    69 AAYDKVLKAKKAAELRSRQLDGKRQKLKLELEERERAALHKLAKSQPY-------STVAKSDEEV 126
            ..||:.|       |..:.|.|...|     ..:...|.....:..||       |..::.|...
  Rat   101 RKYDRGL-------LSDQDLRGPGVK-----PSKTPVADPTPPRPPPYTPRAHGGSRASQGDGRT 153

  Fly   127 LH-----------EQIERLRREGSRLLEEEQRAMQEQFRRNHAEQ 160
            :.           ||:||.||     |...:.|:::: :::||.:
  Rat   154 MFDFDAFYQAHYGEQLERERR-----LRARREALRKK-QKDHASK 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17187NP_650056.1 DnaJ 10..72 CDD:278647 23/61 (38%)
RRM_DNAJC17 175..247 CDD:240875
Dnajc30NP_001102494.1 DnaJ 43..104 CDD:278647 23/60 (38%)
DnaJ 44..>105 CDD:223560 23/60 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2214
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.