DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17187 and Dnajc11

DIOPT Version :9

Sequence 1:NP_650056.1 Gene:CG17187 / 41351 FlyBaseID:FBgn0037882 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_001102164.1 Gene:Dnajc11 / 362666 RGDID:1307731 Length:559 Species:Rattus norvegicus


Alignment Length:208 Identity:53/208 - (25%)
Similarity:87/208 - (41%) Gaps:67/208 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MASKKYSDVNLYDLLGISLESDQNEIRKAYRKKALECHPDK--NPDNPKAVER-FHELSKALEIL 62
            ::.::..:.:.|.||.:..|:...|::.|||:..:..||||  :|:.....|| |:.:.:|.|:|
  Rat     5 LSEEELDNEDYYSLLNVRREASAEELKAAYRRLCMLYHPDKHRDPELKSQAERLFNLVHQAYEVL 69

  Fly    63 TDESARAAYDKVLKAKKAAELRSRQLDGKRQKLKLELEERERAALHKLAKSQPYSTVAKSDEEVL 127
            :|...||.||  :..|:..|:..           .|:.||:|             |.|:     :
  Rat    70 SDPQTRAIYD--IYGKRGLEMEG-----------WEVVERKR-------------TPAE-----I 103

  Fly   128 HEQIERLRREGSRLLEEEQRAMQEQFRRNHAEQQKLQQQPVQFDSAQHRIKMKWKAEPGQDYTQQ 192
            .|:.|||:||                    .|::||||          |...|.....|.|.|  
  Rat   104 REEFERLQRE--------------------REERKLQQ----------RTNPKGTISVGVDAT-- 136

  Fly   193 ELL-KYLKKYGDV 204
            :|. :|.::|.||
  Rat   137 DLFDRYDEEYEDV 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17187NP_650056.1 DnaJ 10..72 CDD:278647 22/64 (34%)
RRM_DNAJC17 175..247 CDD:240875 10/31 (32%)
Dnajc11NP_001102164.1 DnaJ 14..79 CDD:278647 22/64 (34%)
Selenoprotein_S 372..>447 CDD:284376
DUF3395 417..549 CDD:288708
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.