Sequence 1: | NP_650056.1 | Gene: | CG17187 / 41351 | FlyBaseID: | FBgn0037882 | Length: | 299 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001102164.1 | Gene: | Dnajc11 / 362666 | RGDID: | 1307731 | Length: | 559 | Species: | Rattus norvegicus |
Alignment Length: | 208 | Identity: | 53/208 - (25%) |
---|---|---|---|
Similarity: | 87/208 - (41%) | Gaps: | 67/208 - (32%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MASKKYSDVNLYDLLGISLESDQNEIRKAYRKKALECHPDK--NPDNPKAVER-FHELSKALEIL 62
Fly 63 TDESARAAYDKVLKAKKAAELRSRQLDGKRQKLKLELEERERAALHKLAKSQPYSTVAKSDEEVL 127
Fly 128 HEQIERLRREGSRLLEEEQRAMQEQFRRNHAEQQKLQQQPVQFDSAQHRIKMKWKAEPGQDYTQQ 192
Fly 193 ELL-KYLKKYGDV 204 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG17187 | NP_650056.1 | DnaJ | 10..72 | CDD:278647 | 22/64 (34%) |
RRM_DNAJC17 | 175..247 | CDD:240875 | 10/31 (32%) | ||
Dnajc11 | NP_001102164.1 | DnaJ | 14..79 | CDD:278647 | 22/64 (34%) |
Selenoprotein_S | 372..>447 | CDD:284376 | |||
DUF3395 | 417..549 | CDD:288708 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |