DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17187 and Dnajc25

DIOPT Version :9

Sequence 1:NP_650056.1 Gene:CG17187 / 41351 FlyBaseID:FBgn0037882 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_001020192.1 Gene:Dnajc25 / 362526 RGDID:1561488 Length:357 Species:Rattus norvegicus


Alignment Length:300 Identity:62/300 - (20%)
Similarity:98/300 - (32%) Gaps:119/300 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 YDLLGISLESDQNEIRKAYRKKALECHPDK-NPD-------NPKAVERFHELSKALEILTDESAR 68
            |::||:|..:.:.||.:|||:.|...|||: .|:       .|.:.|.|..::.|.|.|.||..|
  Rat    50 YEVLGVSRSASKAEIARAYRQLARRYHPDRYRPEPGDGPGGAPPSAEAFLLVATAYETLKDEETR 114

  Fly    69 AAYDKVLK--------------------------------------------------------- 76
            ..||.:|.                                                         
  Rat   115 KDYDYMLDHPEEYYSHYYHYYSRRLAPKVDVRVVILVSVCAISVFQYFSWWNSYNKSISYLATVP 179

  Fly    77 ---------AKKAAELRSRQLDGKRQKLKLELEERERAALHKLAKSQ-----PYSTVAKSD---E 124
                     ||:...|:..:..||.:|.|.|:.:.|...:..:.||:     .|......|   .
  Rat   180 KYRIQATEIAKEQGLLKKAKEKGKNKKSKEEIRDEEENIIKNIIKSKIDIKGGYQKPQVRDLLLF 244

  Fly   125 EVLHEQIE-------------RLRREGSRLLEEEQRAMQEQFRRNHAEQQKLQQQPVQFDSAQ-H 175
            :||...:.             ....:|....|||         |.:..::.::....||||.: |
  Rat   245 QVLLAPVHLCSYIAWYCRWVYNFNIKGKEYGEEE---------RLYIIRKSMKMSQSQFDSLEDH 300

  Fly   176 RIKM-----KWKAEPGQDYTQ---QELLKYL------KKY 201
            :.:|     .|..|..:.|.|   :||.|.|      |:|
  Rat   301 QKEMFLKRELWIKENYEVYKQEQEEELKKKLANDPRWKRY 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17187NP_650056.1 DnaJ 10..72 CDD:278647 23/67 (34%)
RRM_DNAJC17 175..247 CDD:240875 11/40 (28%)
Dnajc25NP_001020192.1 DnaJ 47..>118 CDD:223560 23/67 (34%)
DnaJ 48..118 CDD:278647 23/67 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.