DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17187 and Dnajc4

DIOPT Version :9

Sequence 1:NP_650056.1 Gene:CG17187 / 41351 FlyBaseID:FBgn0037882 Length:299 Species:Drosophila melanogaster
Sequence 2:XP_008758381.1 Gene:Dnajc4 / 361717 RGDID:1308693 Length:260 Species:Rattus norvegicus


Alignment Length:188 Identity:52/188 - (27%)
Similarity:83/188 - (44%) Gaps:30/188 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 NLYDLLGISLESDQNEIRKAYRKKALECHPDKNPDNPKAVERFHELSKALEILTDESARAAYDKV 74
            |.|:|||:...:...||::|:..|:.|.|||::|.||....||.|||:|..:|:.|.:|..||..
  Rat    53 NYYELLGVHPGASAEEIKRAFFTKSKELHPDRDPGNPALHSRFVELSEAYRVLSREESRRNYDHQ 117

  Fly    75 LKAKKAAELRSRQLDGK-RQKLKLELEERER----AALHKLAKSQPYSTVA--KSDEEVL----- 127
            |.:...::......:.| :|:......|...    |..|.:...:|.|...  |.::.||     
  Rat   118 LHSASPSKSSGSTAEPKYKQQTHSSPWETPNAEYWAQFHSVRPQEPESRKQQHKHNQRVLGYCLL 182

  Fly   128 ------------HEQIERLRR----EGSRLLEEEQRAMQEQFRRNHAE-QQKLQQ-QP 167
                        ..::|::.|    |..|::.......:.:.|.|.|. |||.|| ||
  Rat   183 LMVAGMGLHYVAFRKLEQVHRSFMDEKDRIITAIYNDTRARARANRARIQQKHQQRQP 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17187NP_650056.1 DnaJ 10..72 CDD:278647 25/61 (41%)
RRM_DNAJC17 175..247 CDD:240875
Dnajc4XP_008758381.1 DnaJ 53..115 CDD:395170 25/61 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2214
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.