DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17187 and Rme-8

DIOPT Version :9

Sequence 1:NP_650056.1 Gene:CG17187 / 41351 FlyBaseID:FBgn0037882 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_610467.1 Gene:Rme-8 / 35939 FlyBaseID:FBgn0015477 Length:2408 Species:Drosophila melanogaster


Alignment Length:367 Identity:83/367 - (22%)
Similarity:132/367 - (35%) Gaps:97/367 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 YDLLGISL----ESDQNEIRKAYRKKALECHPDKNPDNPKAVERFHELSKALEILTDESARAA-- 70
            |..|||.|    :.|::.|||:|.|.|...||||||:..   |.|.::::|.|.|...:..::  
  Fly  1304 YQDLGIDLTKTPKPDESMIRKSYYKLAQMYHPDKNPNGR---EIFEKVNQAYEFLCSRNVWSSGG 1365

  Fly    71 -------------------YDKVLKAKKAAELRSRQLDGKRQKLK-LELEERE------RAALHK 109
                               |..||:..|.|        |..|.:| :.||.|:      .|.|..
  Fly  1366 PDPNNIVLILRTQSILFERYPDVLRPYKYA--------GYPQLIKTIRLETRDDELFSKEAQLLT 1422

  Fly   110 LAKSQPYSTV---AKSDEEVLHEQ-IERLRREGSRL-----LEEEQRAMQEQFRRNHAE------ 159
            .|....|.||   |.:.||:..|: ||.|....:|.     ::.:..::..|...|...      
  Fly  1423 AASELCYHTVHCSALNAEELRREEGIEALLEAYTRCVSILGVDSKPDSLHYQVISNVTRCFEVAC 1487

  Fly   160 -----QQKLQQQP---------VQFDSAQHRIKMKWKAE-PGQDYTQQ----------ELLKYLK 199
                 :||:.|.|         |.|   :|.:.:..... ...:|..|          .||.::.
  Fly  1488 NFEKCKQKIIQLPQLLSDVCRVVYF---KHTLSVSLVTSLAANNYDLQCQLSRNGVLWSLLLFIF 1549

  Fly   200 KYG---DVVALVVNSKRRGRAMVELATREA---CDMVLAYEKGDPAKPLHFEWVTPPAAD-KQTT 257
            :|.   |...:.|:.|...:.:.....:.|   |..:..|......||:.......|||. ....
  Fly  1550 EYDYTLDESGVDVSDKSNQQQLANNLAKMAVLGCIALAGYSMELRQKPVTGSETNSPAAKAPPVI 1614

  Fly   258 KSATTGCSASSTDYEDLVMRKLRQAEERKRLIEQMMKDEEGE 299
            |...:..:|||:.|.......|    :.|:|.....|::|.:
  Fly  1615 KPKPSVSAASSSTYTQNAHNPL----QSKQLAITSGKEKESD 1652

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17187NP_650056.1 DnaJ 10..72 CDD:278647 23/84 (27%)
RRM_DNAJC17 175..247 CDD:240875 14/88 (16%)
Rme-8NP_610467.1 DUF4339 972..1020 CDD:290937
DnaJ 1304..1356 CDD:278647 22/54 (41%)
HEAT repeat 2174..2200 CDD:293787
HEAT repeat 2212..2243 CDD:293787
HEAT repeat 2253..2282 CDD:293787
HEAT repeat 2291..2327 CDD:293787
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464440
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.