DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17187 and K07F5.16

DIOPT Version :9

Sequence 1:NP_650056.1 Gene:CG17187 / 41351 FlyBaseID:FBgn0037882 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_001023271.1 Gene:K07F5.16 / 3565979 WormBaseID:WBGene00010640 Length:155 Species:Caenorhabditis elegans


Alignment Length:161 Identity:45/161 - (27%)
Similarity:70/161 - (43%) Gaps:24/161 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 YSDV--------NLYDLLGISLESDQNEIRKAYRKKALECHPDK-NPDNPKAVERFHELSKALEI 61
            :|||        .||.|||....|..::|...||.:..:||||| ...|..:.|:|.||..|..|
 Worm     3 FSDVLDAKPKEPKLYRLLGCDESSSIDQITAEYRARVRDCHPDKVKEHNTNSTEKFMELQNAYSI 67

  Fly    62 LTDESARAAYDKVLKAKKAAELRSRQLDGKRQKLKLELEERERAALH-KLAKSQPYSTVAKSDEE 125
            ||.:|.|..||..|.:........          ..:.::..:.:.| .:.||||  ::|.:..|
 Worm    68 LTSDSRRKTYDSWLHSPFPVSFED----------FTKSQDTFQMSTHWAVPKSQP--SIAANQPE 120

  Fly   126 VLHEQIERLRREGSRLLEEE--QRAMQEQFR 154
            .|.:..:..:.|.||..:.:  |.::...||
 Worm   121 KLSQNFKSEKSEKSRWSDGDRYQSSIASAFR 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17187NP_650056.1 DnaJ 10..72 CDD:278647 25/62 (40%)
RRM_DNAJC17 175..247 CDD:240875
K07F5.16NP_001023271.1 DnaJ 16..78 CDD:365959 25/61 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2214
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.