DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17187 and dnj-13

DIOPT Version :9

Sequence 1:NP_650056.1 Gene:CG17187 / 41351 FlyBaseID:FBgn0037882 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_001366737.1 Gene:dnj-13 / 3564910 WormBaseID:WBGene00001031 Length:331 Species:Caenorhabditis elegans


Alignment Length:62 Identity:27/62 - (43%)
Similarity:43/62 - (69%) Gaps:1/62 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 YDLLGISLESDQNEIRKAYRKKALECHPDKNPDNPKAVERFHELSKALEILTDESARAAYDK 73
            |.:||||..:..:||:|||||.||:.|||||.: ..|..:|.|:::|.::|:|:..:..||:
 Worm     6 YKVLGISKGATDDEIKKAYRKMALKYHPDKNKE-AGAENKFKEIAEAYDVLSDDKKKKIYDQ 66

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17187NP_650056.1 DnaJ 10..72 CDD:278647 25/59 (42%)
RRM_DNAJC17 175..247 CDD:240875
dnj-13NP_001366737.1 DnaJ 1..331 CDD:223560 27/62 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.