DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17187 and Tpr2

DIOPT Version :9

Sequence 1:NP_650056.1 Gene:CG17187 / 41351 FlyBaseID:FBgn0037882 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_001260501.1 Gene:Tpr2 / 34984 FlyBaseID:FBgn0032586 Length:508 Species:Drosophila melanogaster


Alignment Length:110 Identity:37/110 - (33%)
Similarity:54/110 - (49%) Gaps:29/110 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ASKKYSDVNLYDLLGISLESDQNEIRKAYRKKALECHPDKNPDNPKAVER------FHELSKALE 60
            |.||....:.|.:|||...:..:||:||||||||..|||::. |..|.||      |.|:.:|..
  Fly   394 ALKKSKRKDYYKILGIGRNASDDEIKKAYRKKALVHHPDRHA-NSSAEERKEEELKFKEVGEAYA 457

  Fly    61 ILTDESARAAYDKVLKAKKAAELRSRQLDGKRQKLKLELEERERA 105
            ||:|...::.||                .|:      ::||:|:|
  Fly   458 ILSDAHKKSRYD----------------SGQ------DIEEQEQA 480

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17187NP_650056.1 DnaJ 10..72 CDD:278647 27/67 (40%)
RRM_DNAJC17 175..247 CDD:240875
Tpr2NP_001260501.1 TPR_11 49..114 CDD:290150
TPR repeat 49..77 CDD:276809
TPR repeat 82..112 CDD:276809
TPR_11 201..262 CDD:290150
TPR repeat 201..225 CDD:276809
TPR_1 231..264 CDD:278916
TPR repeat 231..259 CDD:276809
TPR_11 278..345 CDD:290150
TPR repeat 310..344 CDD:276809
TPR_11 314..380 CDD:290150
TPR repeat 349..377 CDD:276809
DnaJ 401..>503 CDD:223560 34/103 (33%)
DnaJ 402..469 CDD:278647 27/67 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464421
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.