Sequence 1: | NP_650056.1 | Gene: | CG17187 / 41351 | FlyBaseID: | FBgn0037882 | Length: | 299 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001015187.2 | Gene: | l(3)80Fg / 3354941 | FlyBaseID: | FBgn0287183 | Length: | 780 | Species: | Drosophila melanogaster |
Alignment Length: | 249 | Identity: | 50/249 - (20%) |
---|---|---|---|
Similarity: | 91/249 - (36%) | Gaps: | 97/249 - (38%) |
- Green bases have known domain annotations that are detailed below.
Fly 12 YDLLGISLESDQNEIRKAYRKKALECHPDKNPDNPKAVERFHELSKALEILTDESARAAYDKVLK 76
Fly 77 AKKAAELRSRQLD----------------GKR----------QKLKLELEERERAALHKLAKS-- 113
Fly 114 --------------------------QP----YSTVAKSDEEVLHEQIERLRREGSRLLEEEQRA 148
Fly 149 MQEQF--RRNHAEQQKLQQQPVQFDSAQHRIKMKWKAEPGQDYTQQELLKYLKK 200 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG17187 | NP_650056.1 | DnaJ | 10..72 | CDD:278647 | 23/59 (39%) |
RRM_DNAJC17 | 175..247 | CDD:240875 | 3/26 (12%) | ||
l(3)80Fg | NP_001015187.2 | DnaJ | 30..>94 | CDD:223560 | 24/62 (39%) |
DnaJ | 30..91 | CDD:278647 | 23/59 (39%) | ||
TRX_DnaJ | 134..244 | CDD:239261 | 23/146 (16%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C45464408 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.840 |