DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17187 and l(3)80Fg

DIOPT Version :9

Sequence 1:NP_650056.1 Gene:CG17187 / 41351 FlyBaseID:FBgn0037882 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_001015187.2 Gene:l(3)80Fg / 3354941 FlyBaseID:FBgn0287183 Length:780 Species:Drosophila melanogaster


Alignment Length:249 Identity:50/249 - (20%)
Similarity:91/249 - (36%) Gaps:97/249 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 YDLLGISLESDQNEIRKAYRKKALECHPDKNPDNPKAVERFHELSKALEILTDESARAAYDKVLK 76
            |.:|||:.::...|||:||::.|.:.|||| ..|....|:|.::..|.|||.|...|..:|:...
  Fly    32 YAILGINKKATTYEIREAYKELAKKWHPDK-VKNDYGAEKFIQIKLAYEILADLDRRRIFDRYGV 95

  Fly    77 AKKAAELRSRQLD----------------GKR----------QKLKLELEERERAALHKLAKS-- 113
            :...::...::.|                |:|          |||.:.....|:..|.|.||.  
  Fly    96 SDINSQYFQKKHDYSEYNRFTLNQNDDDFGQRFDIKQDIAFYQKLSITENYFEKMILSKNAKKVH 160

  Fly   114 --------------------------QP----YSTVAKSDEEVLHEQIERLRREGSRLLEEEQRA 148
                                      ||    ::||     ..:||: ...|:.|:|.:.:....
  Fly   161 VVMFYNDWCFKCTRIVDAFKKILELLQPIGINFATV-----NAVHEE-SVFRKCGAREVPQLVLI 219

  Fly   149 MQEQF--RRNHAEQQKLQQQPVQFDSAQHRIKMKWKAEPGQDYTQQELLKYLKK 200
            :..|:  .|:|:                              :|.|:::::::|
  Fly   220 LDNQYFLYRDHS------------------------------FTPQKVVEFIRK 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17187NP_650056.1 DnaJ 10..72 CDD:278647 23/59 (39%)
RRM_DNAJC17 175..247 CDD:240875 3/26 (12%)
l(3)80FgNP_001015187.2 DnaJ 30..>94 CDD:223560 24/62 (39%)
DnaJ 30..91 CDD:278647 23/59 (39%)
TRX_DnaJ 134..244 CDD:239261 23/146 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464408
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.