DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17187 and CG7872

DIOPT Version :9

Sequence 1:NP_650056.1 Gene:CG17187 / 41351 FlyBaseID:FBgn0037882 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_573044.1 Gene:CG7872 / 32493 FlyBaseID:FBgn0030658 Length:333 Species:Drosophila melanogaster


Alignment Length:176 Identity:48/176 - (27%)
Similarity:84/176 - (47%) Gaps:27/176 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 NLYDLLGISLESDQNEIRKAYRKKALECHPD--KNPDNPKAVE-RFHELSKALEILTDESARAAY 71
            |.||:||::.||.::||.||||:.|...|||  :..:...|.| :|..::.|.|||.||.:|..|
  Fly    31 NCYDVLGVTRESSKSEIGKAYRQLARRYHPDLHRGAEAKAAAETQFKLVATAYEILRDEESRTDY 95

  Fly    72 DKVLKAKKAAELRSRQLDGKRQKLKLELE-------------------ERERAALHKLAKSQPYS 117
            |.:|....|......:...:|...|:::.                   :|..:|:...|....|.
  Fly    96 DYMLDNPDAYYAHYYRYYRRRVAPKVDVRVVIVVVLTIVSVIQYYSGWQRYDSAIKYFATVPKYR 160

  Fly   118 TVAKSDEEVLHEQI-ERLRREG-SRLLEEEQRAMQEQFRRNHAEQQ 161
            ..|.   |:..::| |:::::| :|:.:.:||...|:..|...|::
  Fly   161 NQAL---EIARDEIQEKIQKKGKNRMSKNDQRDELERIIRRVIEEK 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17187NP_650056.1 DnaJ 10..72 CDD:278647 27/64 (42%)
RRM_DNAJC17 175..247 CDD:240875
CG7872NP_573044.1 DnaJ 31..96 CDD:278647 27/64 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464442
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.