DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17187 and dnajc4

DIOPT Version :9

Sequence 1:NP_650056.1 Gene:CG17187 / 41351 FlyBaseID:FBgn0037882 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_997842.1 Gene:dnajc4 / 324373 ZFINID:ZDB-GENE-030131-3093 Length:237 Species:Danio rerio


Alignment Length:206 Identity:49/206 - (23%)
Similarity:92/206 - (44%) Gaps:20/206 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 SDVNLYDLLGISLESDQNEIRKAYRKKALECHPDKNPDNPKAVERFHELSKALEILTDESARAAY 71
            |..|.|:|||:..::...:|:.|:..|:.:.|||.:|.||....:|.:|::|..:|:.|.:|..|
Zfish    32 SQTNYYELLGVKPDATLEQIKFAFFDKSKKLHPDSDPSNPGLHTQFVQLNEAYRVLSKEGSRQDY 96

  Fly    72 DKVLKAKKAAELRSRQLDGKRQKLKLELEERERAALHKLAKSQPYSTVAKSDEEVLHEQIERLRR 136
            |..|:.:.|.....|...........|..|..| ...:..::||        :|...|:.|:.::
Zfish    97 DLRLRYQYAGGQAFRTSSSSSNNPSWEANESMR-YWEQFRQAQP--------QENTPEEREKKKK 152

  Fly   137 EGSRLLEEEQRAMQEQFRRNHAEQQKLQQQPVQFDSAQHRI------KMKWKAEPGQDYTQQELL 195
            ...||:.....||......::...:||::....|...:.|:      :.|.:|.......|||:|
Zfish   153 RNMRLVGYCFLAMILSVSAHYFGFRKLEEVHNNFMDEKDRVITKIYNESKERARANGIKKQQEIL 217

  Fly   196 K-----YLKKY 201
            :     :|:::
Zfish   218 RQKHAEFLERF 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17187NP_650056.1 DnaJ 10..72 CDD:278647 20/61 (33%)
RRM_DNAJC17 175..247 CDD:240875 8/38 (21%)
dnajc4NP_997842.1 DnaJ 35..97 CDD:278647 20/61 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2214
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.