DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17187 and dnaja2b

DIOPT Version :9

Sequence 1:NP_650056.1 Gene:CG17187 / 41351 FlyBaseID:FBgn0037882 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_997830.1 Gene:dnaja2b / 324164 ZFINID:ZDB-GENE-030131-2884 Length:413 Species:Danio rerio


Alignment Length:306 Identity:66/306 - (21%)
Similarity:112/306 - (36%) Gaps:110/306 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 SDVNLYDLLGISLESDQNEIRKAYRKKALECHPDKNPDNPKAVERFHELSKALEILTDESARAAY 71
            :|..||||||:|..:.:||::|||||.|.|.||||||:   |.::|.|:|.|.|:||:...:..|
Zfish     5 ADTKLYDLLGVSPSASENELKKAYRKLAKEYHPDKNPN---AGDKFKEISFAYEVLTNPEKKDLY 66

  Fly    72 DKV-----------------------------------LKAKKAAELRSRQL------------D 89
            |:.                                   .|::.....|...:            :
Zfish    67 DRYGEQGLREGGGGGAGMEDIFSHIFGGGLFGFMGGQSSKSRNGGRRRGEDMIHPLKVSLEDLYN 131

  Fly    90 GKRQKLKLELE------------------------ERERAALHKLA-----KSQPYSTVAKSDEE 125
            ||..||:|...                        ...|..:.:||     :.|...|....:.|
Zfish   132 GKTTKLQLSKNVLCSACNGQGGKTGAVQKCSTCRGRGMRIMIRQLAPGMVQQMQSVCTDCNGEGE 196

  Fly   126 VLHEQIERLRREGSRLLEEEQRAMQEQFRRNHAEQQKLQQQPVQFDSAQHRIKMKWKAEPGQDYT 190
            |:||: :|.:....|.:.:|.:.::.     |.::           ..:|..|:.:..|..|...
Zfish   197 VIHEK-DRCKECDGRKVCKEVKVLEV-----HVDK-----------GMKHGQKITFSGEADQSPN 244

  Fly   191 QQELLKYLKKYGDVVALVVNSKRRGRAMVELATREACDMVLAYEKG 236
            .:.        ||:: ||:..|..     |...|:..|:.:.::.|
Zfish   245 TEP--------GDII-LVLQEKDH-----EEFRRDGNDLHIGHKIG 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17187NP_650056.1 DnaJ 10..72 CDD:278647 30/61 (49%)
RRM_DNAJC17 175..247 CDD:240875 13/62 (21%)
dnaja2bNP_997830.1 PTZ00037 4..413 CDD:240236 66/306 (22%)
DnaJ 9..67 CDD:278647 30/60 (50%)
DnaJ_C 116..342 CDD:199909 31/192 (16%)
DnaJ_zf 145..211 CDD:199908 10/66 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.