Sequence 1: | NP_650056.1 | Gene: | CG17187 / 41351 | FlyBaseID: | FBgn0037882 | Length: | 299 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_997830.1 | Gene: | dnaja2b / 324164 | ZFINID: | ZDB-GENE-030131-2884 | Length: | 413 | Species: | Danio rerio |
Alignment Length: | 306 | Identity: | 66/306 - (21%) |
---|---|---|---|
Similarity: | 112/306 - (36%) | Gaps: | 110/306 - (35%) |
- Green bases have known domain annotations that are detailed below.
Fly 7 SDVNLYDLLGISLESDQNEIRKAYRKKALECHPDKNPDNPKAVERFHELSKALEILTDESARAAY 71
Fly 72 DKV-----------------------------------LKAKKAAELRSRQL------------D 89
Fly 90 GKRQKLKLELE------------------------ERERAALHKLA-----KSQPYSTVAKSDEE 125
Fly 126 VLHEQIERLRREGSRLLEEEQRAMQEQFRRNHAEQQKLQQQPVQFDSAQHRIKMKWKAEPGQDYT 190
Fly 191 QQELLKYLKKYGDVVALVVNSKRRGRAMVELATREACDMVLAYEKG 236 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG17187 | NP_650056.1 | DnaJ | 10..72 | CDD:278647 | 30/61 (49%) |
RRM_DNAJC17 | 175..247 | CDD:240875 | 13/62 (21%) | ||
dnaja2b | NP_997830.1 | PTZ00037 | 4..413 | CDD:240236 | 66/306 (22%) |
DnaJ | 9..67 | CDD:278647 | 30/60 (50%) | ||
DnaJ_C | 116..342 | CDD:199909 | 31/192 (16%) | ||
DnaJ_zf | 145..211 | CDD:199908 | 10/66 (15%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |