DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17187 and dnajb12a

DIOPT Version :9

Sequence 1:NP_650056.1 Gene:CG17187 / 41351 FlyBaseID:FBgn0037882 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_997824.1 Gene:dnajb12a / 324005 ZFINID:ZDB-GENE-030131-2725 Length:371 Species:Danio rerio


Alignment Length:279 Identity:63/279 - (22%)
Similarity:99/279 - (35%) Gaps:100/279 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ASKKYSDVNL------------YDLLGISLESDQNEIRKAYRKKALECHPDKNPDNPKAVERFHE 54
            ::|.|:...|            |:.||:|.|:.:.:::|||||.||:.||||| ..|.|.|.|..
Zfish    88 SAKPYTSEQLDAVKRIKRCKDYYETLGVSKEASEEDLKKAYRKLALKFHPDKN-HAPGATEAFKA 151

  Fly    55 LSKALEILTDESARAAYDKVLKAKKA--------------AEL---------------------- 83
            :..|..:|::...|..|| |...:||              |::                      
Zfish   152 IGNAYAVLSNPEKRRQYD-VYGEEKAHPTHRHRTYHRNFEADISPEDLFNMFFGGGFPTSNVHVY 215

  Fly    84 -RSRQLDGKRQKLKLELEERE------------------RAALHKLAKSQPYSTVAKSDEEVLHE 129
             ..|...|.:|:.:.:.::||                  .|....:..|.|||...:  ..:.|.
Zfish   216 SNGRMRFGHQQRHERQEQQREGGLALFVQLMPILILIIVSALSQMMVSSPPYSLSHR--PSLGHT 278

  Fly   130 QIERLRREGSRL---------LEEEQRAMQEQFRRNHAEQQKLQQQPVQFDSAQHRIKMKWKAEP 185
            .    ||:.:.|         ..||.:.|          ..|..:|.|:.|...:.....||   
Zfish   279 S----RRQTATLKVPYYVGDHFSEEYKGM----------NLKNVEQSVEEDYISNLRNNCWK--- 326

  Fly   186 GQDYTQQELLKYLKKY-GD 203
              :..|:|.|.|..:| ||
Zfish   327 --EKQQKEGLLYRARYFGD 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17187NP_650056.1 DnaJ 10..72 CDD:278647 25/73 (34%)
RRM_DNAJC17 175..247 CDD:240875 9/30 (30%)
dnajb12aNP_997824.1 DnaJ 107..>211 CDD:223560 30/105 (29%)
DnaJ 108..169 CDD:278647 24/61 (39%)
DUF1977 263..363 CDD:286411 24/102 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.