DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17187 and Dnajc12

DIOPT Version :9

Sequence 1:NP_650056.1 Gene:CG17187 / 41351 FlyBaseID:FBgn0037882 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_038916.1 Gene:Dnajc12 / 30045 MGIID:1353428 Length:198 Species:Mus musculus


Alignment Length:213 Identity:54/213 - (25%)
Similarity:92/213 - (43%) Gaps:55/213 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 YDLLGISLESDQNEIRKAYRKKALECHPDKNPDNPKAVERFHELSKALEILTDESARAAYDKVLK 76
            |.|||....|...:|...::.:||||||||:|:|.||||.|.:|.||.|||.:..:||.||    
Mouse    16 YALLGCDELSSVEQILAEFKIRALECHPDKHPENSKAVETFQKLQKAKEILCNAESRARYD---- 76

  Fly    77 AKKAAELRSRQLDGKRQKLKLELEERERAALHKLAKSQPYSTVAKSDEEVLHEQIERLRREGS-- 139
                        ..:|.::.:..|:.| |....:..|..::..:|.|          |..|||  
Mouse    77 ------------HWRRSQMSMPFEQWE-ALADSVKTSMHWAVRSKKD----------LMLEGSGQ 118

  Fly   140 ---RLLEEEQRAMQEQFRRNHAEQ--QKLQQQPVQFD----SAQH------------RIKMKWKA 183
               ..:..::|:.|.:.::...:.  :|::|:..:|.    |.|:            .::.:|..
Mouse   119 TFTSSVPNKERSEQRETKKGDPDSNPEKMKQKEPKFPEEGISPQNPDSPGLSDLNCGHLRFRWSG 183

  Fly   184 EPGQDYTQQELLKYLKKY 201
            :     ...|||:..:.|
Mouse   184 D-----APSELLRKFRNY 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17187NP_650056.1 DnaJ 10..72 CDD:278647 29/59 (49%)
RRM_DNAJC17 175..247 CDD:240875 5/39 (13%)
Dnajc12NP_038916.1 DnaJ 14..76 CDD:278647 29/59 (49%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 114..177 10/62 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2214
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.