DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17187 and RGD1565752

DIOPT Version :9

Sequence 1:NP_650056.1 Gene:CG17187 / 41351 FlyBaseID:FBgn0037882 Length:299 Species:Drosophila melanogaster
Sequence 2:XP_017450030.1 Gene:RGD1565752 / 299172 RGDID:1565752 Length:303 Species:Rattus norvegicus


Alignment Length:316 Identity:134/316 - (42%)
Similarity:193/316 - (61%) Gaps:39/316 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SKKYSDVNLYDLLGISLESDQNEIRKAYRKKALECHPDKNPDNPKAVERFHELSKALEILTDESA 67
            :|::..::||.||||..::...|::||||:|||.|||||||||.:|.|.||:||:|||:|||.:|
  Rat     4 TKEFLQMDLYTLLGIEEKATDKEVKKAYRQKALSCHPDKNPDNLRAAELFHQLSQALEVLTDAAA 68

  Fly    68 RAAYDKVLKAKKAAELRSRQLDGKRQKLKLELEERERAALHKLAKSQPYSTVAKSDEE-----VL 127
            |.||||..||:|.|..|:::||..|:||||:||.|||.|       |...|  :.:||     .|
  Rat    69 RTAYDKERKARKRAAERTQRLDENRKKLKLDLEARERQA-------QAQGT--EEEEESRSTTTL 124

  Fly   128 HEQIERLRREGSRLLEEEQRAMQEQFR-------RNHAEQQKLQQQPVQFDSAQHRIKMKW---- 181
            .::|.||:.||||.|||:||.:|||.|       |..||.::.::.|        ::|:||    
  Rat   125 EQKIARLQEEGSRQLEEQQRLIQEQTRQDRKQRLRGRAENREGKRTP--------KLKLKWTCKK 181

  Fly   182 --KAEPGQDYTQQELLKYLKKYGDVVALVVNSKRRGRAMVELATREACDMVLAYEKGDPAKPLHF 244
              |::.|  |::..|||.|.|||:|:.|||:.::.|.|:||.||..|.::.:..|.|....||..
  Rat   182 EDKSQGG--YSRDVLLKLLHKYGEVLNLVVSGRKPGNAIVEFATVRAAELAVRNEVGLTDNPLKV 244

  Fly   245 EWV--TPPAADKQTTKSATTGCSASSTDYEDLVMRKLRQAEERKRLIEQMMKDEEG 298
            .|:  .|......:....|.|..:|..|||.|||.::|||.||::|:.||.:::||
  Rat   245 SWLEGQPQGTVDPSPPGLTKGSVSSERDYEGLVMMRMRQAAERQQLMAQMQQEDEG 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17187NP_650056.1 DnaJ 10..72 CDD:278647 38/61 (62%)
RRM_DNAJC17 175..247 CDD:240875 28/77 (36%)
RGD1565752XP_017450030.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1405648at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.