powered by:
Protein Alignment CG17187 and Dnajc10
DIOPT Version :9
Sequence 1: | NP_650056.1 |
Gene: | CG17187 / 41351 |
FlyBaseID: | FBgn0037882 |
Length: | 299 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001099956.2 |
Gene: | Dnajc10 / 295690 |
RGDID: | 1307813 |
Length: | 793 |
Species: | Rattus norvegicus |
Alignment Length: | 67 |
Identity: | 33/67 - (49%) |
Similarity: | 46/67 - (68%) |
Gaps: | 0/67 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 7 SDVNLYDLLGISLESDQNEIRKAYRKKALECHPDKNPDNPKAVERFHELSKALEILTDESARAAY 71
:|.|.|.|||:|..:...|||:|::|.||:.||||||:||.|...|.::::|.|:|.||..|..|
Rat 32 TDQNFYSLLGVSKTASSREIRQAFKKLALKLHPDKNPNNPNAHGDFLKINRAYEVLKDEDLRKKY 96
Fly 72 DK 73
||
Rat 97 DK 98
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.910 |
|
Return to query results.
Submit another query.