DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17187 and DNAJC15

DIOPT Version :9

Sequence 1:NP_650056.1 Gene:CG17187 / 41351 FlyBaseID:FBgn0037882 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_037370.2 Gene:DNAJC15 / 29103 HGNCID:20325 Length:150 Species:Homo sapiens


Alignment Length:50 Identity:16/50 - (32%)
Similarity:27/50 - (54%) Gaps:1/50 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LLGISLESDQNEIRKAYRKKALECHPDKNPDNPKAVERFHELSKALEILT 63
            :||:|..:.:.:||.|:|:..:..||||. .:|....:.:|....||..|
Human   100 ILGVSPSAGKAKIRTAHRRVMILNHPDKG-GSPYVAAKINEAKDLLETTT 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17187NP_650056.1 DnaJ 10..72 CDD:278647 15/49 (31%)
RRM_DNAJC17 175..247 CDD:240875
DNAJC15NP_037370.2 DnaJ 41..144 CDD:295354 13/44 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2214
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.