powered by:
Protein Alignment CG17187 and DNAJC15
DIOPT Version :9
Sequence 1: | NP_650056.1 |
Gene: | CG17187 / 41351 |
FlyBaseID: | FBgn0037882 |
Length: | 299 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_037370.2 |
Gene: | DNAJC15 / 29103 |
HGNCID: | 20325 |
Length: | 150 |
Species: | Homo sapiens |
Alignment Length: | 50 |
Identity: | 16/50 - (32%) |
Similarity: | 27/50 - (54%) |
Gaps: | 1/50 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 14 LLGISLESDQNEIRKAYRKKALECHPDKNPDNPKAVERFHELSKALEILT 63
:||:|..:.:.:||.|:|:..:..||||. .:|....:.:|....||..|
Human 100 ILGVSPSAGKAKIRTAHRRVMILNHPDKG-GSPYVAAKINEAKDLLETTT 148
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG17187 | NP_650056.1 |
DnaJ |
10..72 |
CDD:278647 |
15/49 (31%) |
RRM_DNAJC17 |
175..247 |
CDD:240875 |
|
DNAJC15 | NP_037370.2 |
DnaJ |
41..144 |
CDD:295354 |
13/44 (30%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG2214 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.