DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17187 and SPAC1071.09c

DIOPT Version :9

Sequence 1:NP_650056.1 Gene:CG17187 / 41351 FlyBaseID:FBgn0037882 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_594359.1 Gene:SPAC1071.09c / 2542992 PomBaseID:SPAC1071.09c Length:282 Species:Schizosaccharomyces pombe


Alignment Length:243 Identity:60/243 - (24%)
Similarity:110/243 - (45%) Gaps:52/243 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 DVNLYDLLGISLESDQNEIRKAYRKKALECHPDKNPDNPKAVE---RFHELSKALEILTDESARA 69
            |::.|.:||:..::....||:|||||||:.|||:..|..|.||   .|.:::.|..:|:|:..|.
pombe    29 DIDPYSVLGVEKDASDELIRRAYRKKALQHHPDRIHDEEKKVEARIEFDKVAIAYGVLSDKKRRK 93

  Fly    70 AYDKVLKAKKAAELRSRQLDGKRQKLKLELEERE-----------RAALHKLAKSQPYSTVAKSD 123
            .||      |..:||....|       ::.:.:|           ...|::...|..||...|.|
pombe    94 HYD------KTGQLRETDAD-------IDFDWKEWLDELYQGVVSGETLNEFKASYQYSEEEKCD 145

  Fly   124 EEVLHEQIERLRREGSR--LLEEE---QRAMQEQFRR--NHAEQQKLQQQPVQFDSAQHRIKMKW 181
            ....:|     :.:||.  :|||.   :.:.:::||:  |:|.:.....:..:|...:.:.|.:.
pombe   146 VLKAYE-----KGKGSMDVILEEVMCCEISDEDRFRQVINNAIKDGKISKYKRFAPNEKKRKRRA 205

  Fly   182 KAEPGQDYTQQEL---------LKYLKKYG----DVVALVVNSKRRGR 216
            ||...:....:||         ||..:|.|    :.::.::.|:::.|
pombe   206 KAAEREAQEAEELSMELGLDENLKKRRKAGASDEEALSALIRSRQKSR 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17187NP_650056.1 DnaJ 10..72 CDD:278647 24/64 (38%)
RRM_DNAJC17 175..247 CDD:240875 11/55 (20%)
SPAC1071.09cNP_594359.1 DnaJ 31..96 CDD:278647 24/64 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2214
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.