DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG17187 and CG30156

DIOPT Version :9

Sequence 1:	NP_650056.1	Gene:	CG17187 / 41351	FlyBaseID:	FBgn0037882	Length:	299	Species:	Drosophila melanogaster
Sequence 2:	NP_001260752.1	Gene:	CG30156 / 246488	FlyBaseID:	FBgn0050156	Length:	358	Species:	Drosophila melanogaster

Alignment Length:	63	Identity:	26/63 - (41%)
Similarity:	39/63 - (61%)	Gaps:	1/63 - (1%)

- Green bases have known domain annotations that are detailed below.

  Fly    10 NLYDLLGISLESDQNEIRKAYRKKALECHPDKNPDNPKAVERFHELSKALEILTDESARAAYD 72
            |.|::|.||..:..:|:::||.|.||..||||| .:|.|.:.|..:|:|.:.|||...|..|:
  Fly    96 NHYEVLRISHHATYSEVKRAYHKLALRLHPDKN-KSPGAEQAFRRISEAADCLTDCQKRIEYN 157

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG17187	NP_650056.1	DnaJ	10..72	CDD:278647	25/61 (41%)
CG17187	NP_650056.1	RRM_DNAJC17	175..247	CDD:240875
CG30156	NP_001260752.1	DnaJ	96..157	CDD:278647	25/61 (41%)
CG30156	NP_001260752.1	DUF1977	237..334	CDD:286411
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
	1	0.910