DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17187 and DNAJC9

DIOPT Version :9

Sequence 1:NP_650056.1 Gene:CG17187 / 41351 FlyBaseID:FBgn0037882 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_056005.1 Gene:DNAJC9 / 23234 HGNCID:19123 Length:260 Species:Homo sapiens


Alignment Length:244 Identity:49/244 - (20%)
Similarity:98/244 - (40%) Gaps:50/244 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MASKKYSDVNLYDLLGISLESDQNEIRKAYRKKALECHPDK--NPDNPKAVERFHELSKALEILT 63
            :..:.:...:||.:||:..|:...|:|:.|.|.:|:.|||:  ..|...|..||..|.|...:|:
Human     6 LCEEVFGTADLYRVLGVRREASDGEVRRGYHKVSLQVHPDRVGEGDKEDATRRFQILGKVYSVLS 70

  Fly    64 DESARAAYDKVLKAKKAAELRSRQLDGKR------QKLKLE----LEERERAALHKLAKSQPYST 118
            |...||.||:.....:.:.:.::..|.:.      :|:.||    .|:..:.:..:||..:....
Human    71 DREQRAVYDEQGTVDEDSPVLTQDRDWEAYWRLLFKKISLEDIQAFEKTYKGSEEELADIKQAYL 135

  Fly   119 VAKSDEEVLHEQI--------ERLR-------------------REGSRLLEEEQRAMQEQFRRN 156
            ..|.|.:.:.|.:        .|:|                   :|..:.:...:|..||:    
Human   136 DFKGDMDQIMESVLCVQYTEEPRIRNIIQQAIDAGEVPSYNAFVKESKQKMNARKRRAQEE---- 196

  Fly   157 HAEQQKLQQQPVQFDSAQHRIK------MKWKAEPGQDYTQQELLKYLK 199
             |::.::.::.:..|.....:|      .|.:.:...::..|...||.|
Human   197 -AKEAEMSRKELGLDEGVDSLKAAIQSRQKDRQKEMDNFLAQMEAKYCK 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17187NP_650056.1 DnaJ 10..72 CDD:278647 23/63 (37%)
RRM_DNAJC17 175..247 CDD:240875 6/31 (19%)
DNAJC9NP_056005.1 DnaJ 15..79 CDD:278647 23/63 (37%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 185..208 4/27 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2214
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.