Sequence 1: | NP_650056.1 | Gene: | CG17187 / 41351 | FlyBaseID: | FBgn0037882 | Length: | 299 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_055095.2 | Gene: | DNAJC8 / 22826 | HGNCID: | 15470 | Length: | 253 | Species: | Homo sapiens |
Alignment Length: | 206 | Identity: | 51/206 - (24%) |
---|---|---|---|
Similarity: | 95/206 - (46%) | Gaps: | 39/206 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 6 YSDVNLYDLLGISLESDQNEIRKAYRKKALECHPDKNPDN-PKAVERFHELSKALEILTD-ESAR 68
Fly 69 AAYDKVLKAKKAAE----LRSRQL--DGK-----------------RQKLKL--ELE----ERER 104
Fly 105 AALHKLAKSQPYSTVAKSDEEVLHEQIERLRREGSRLLEEEQRAMQEQFRRNHAEQQKLQQQPVQ 169
Fly 170 FDSAQHRIKMK 180 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG17187 | NP_650056.1 | DnaJ | 10..72 | CDD:278647 | 22/63 (35%) |
RRM_DNAJC17 | 175..247 | CDD:240875 | 2/6 (33%) | ||
DNAJC8 | NP_055095.2 | CbpA | 51..>238 | CDD:225124 | 49/192 (26%) |
DnaJ | 57..112 | CDD:99751 | 19/54 (35%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 181..253 | 12/78 (15%) | |||
Nuclear localization signal. /evidence=ECO:0000305|PubMed:27133716 | 189..192 | 0/2 (0%) | |||
Nuclear localization signal. /evidence=ECO:0000305|PubMed:27133716 | 203..206 | 0/2 (0%) | |||
Essential for polyglutamine aggregation suppression. /evidence=ECO:0000269|PubMed:27133716 | 232..253 | 2/19 (11%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |