DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17187 and DNAJC8

DIOPT Version :9

Sequence 1:NP_650056.1 Gene:CG17187 / 41351 FlyBaseID:FBgn0037882 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_055095.2 Gene:DNAJC8 / 22826 HGNCID:15470 Length:253 Species:Homo sapiens


Alignment Length:206 Identity:51/206 - (24%)
Similarity:95/206 - (46%) Gaps:39/206 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 YSDVNLYDLLGISLESDQNEIRKAYRKKALECHPDKNPDN-PKAVERFHELSKALEILTD-ESAR 68
            |.::|.:::|.|..|....||:|.:|:.::..|||||.|: .:|.:.|..:.||.::|.| |..:
Human    53 YFNLNPFEVLQIDPEVTDEEIKKRFRQLSILVHPDKNQDDADRAQKAFEAVDKAYKLLLDQEQKK 117

  Fly    69 AAYDKVLKAKKAAE----LRSRQL--DGK-----------------RQKLKL--ELE----ERER 104
            .|.|.:...|:..|    .|.:||  :||                 :|.:||  |||    |||.
Human   118 RALDVIQAGKEYVEHTVKERKKQLKKEGKPTIVEEDDPELFKQAVYKQTMKLFAELEIKRKEREA 182

  Fly   105 AALHKLAKSQPYSTVAKSDEEVLHEQIERLRREGSRLLEEEQRAMQEQFRRNHAEQQKLQQQPVQ 169
            ..:|:..:.:        :||:..::..:..||..:..||.:....:.:|...|..:..:::..:
Human   183 KEMHERKRQR--------EEEIEAQEKAKREREWQKNFEESRDGRVDSWRNFQANTKGKKEKKNR 239

  Fly   170 FDSAQHRIKMK 180
            ......::||:
Human   240 TFLRPPKVKME 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17187NP_650056.1 DnaJ 10..72 CDD:278647 22/63 (35%)
RRM_DNAJC17 175..247 CDD:240875 2/6 (33%)
DNAJC8NP_055095.2 CbpA 51..>238 CDD:225124 49/192 (26%)
DnaJ 57..112 CDD:99751 19/54 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 181..253 12/78 (15%)
Nuclear localization signal. /evidence=ECO:0000305|PubMed:27133716 189..192 0/2 (0%)
Nuclear localization signal. /evidence=ECO:0000305|PubMed:27133716 203..206 0/2 (0%)
Essential for polyglutamine aggregation suppression. /evidence=ECO:0000269|PubMed:27133716 232..253 2/19 (11%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.