DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17187 and dnj-26

DIOPT Version :9

Sequence 1:NP_650056.1 Gene:CG17187 / 41351 FlyBaseID:FBgn0037882 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_502326.1 Gene:dnj-26 / 178171 WormBaseID:WBGene00001044 Length:365 Species:Caenorhabditis elegans


Alignment Length:279 Identity:55/279 - (19%)
Similarity:97/279 - (34%) Gaps:97/279 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 NLYDLLGISLESDQNEIRKAYRKKALECHPDKNPDNPKAVERFHELSKALEILTDESARAAYDKV 74
            :.|.:|.:..::..:|||.|:||:..|.|||| ..:|.|.|....::.|..:|.|.:.|..|| :
 Worm    27 DFYKILNVDKKASPDEIRIAFRKRIREVHPDK-CKHPSATEASKVVNNAFSLLMDPAKRRQYD-L 89

  Fly    75 LKAKKAAELRSRQLDGKRQKLKLELEERERAALHKLAKSQPYSTVAKSDEEVLHEQIERLRREGS 139
            ..|:.:.|...::.:..:.:.|.|....:|.. ||  ||:|                    ..|.
 Worm    90 QNAETSNENLYKRCNRNKNQRKQEYSNTQRQN-HK--KSEP--------------------SNGK 131

  Fly   140 RLLEEEQRAMQEQFRRNHAEQQKLQQQPVQFDSAQHRIK-MKWKAEPGQDYTQQELLKYLKKYGD 203
            |   .||.:   .|:::|             :|..|:.. .|.|.:....|:.|......:|   
 Worm   132 R---NEQNS---SFKQDH-------------NSKNHQSNHQKTKNKKSNPYSNQNNFNNTRK--- 174

  Fly   204 VVALVVNSKRRGRAMVELATREACDMVLAYEKGDPAKPLHFEWVTPPAADKQTTKSATTGCSASS 268
                                                             |.:..||..:..:.|:
 Worm   175 -------------------------------------------------DYREEKSGFSWNTGSA 190

  Fly   269 TDYEDLVMRKLRQAEERKR 287
            .||||.|.|..:..:::::
 Worm   191 DDYEDFVYRNYQSYQQQQQ 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17187NP_650056.1 DnaJ 10..72 CDD:278647 20/61 (33%)
RRM_DNAJC17 175..247 CDD:240875 6/72 (8%)
dnj-26NP_502326.1 DnaJ 27..88 CDD:365959 20/61 (33%)
DUF4887 <81..174 CDD:374444 25/135 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.