DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17187 and dnj-2

DIOPT Version :9

Sequence 1:NP_650056.1 Gene:CG17187 / 41351 FlyBaseID:FBgn0037882 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_502126.1 Gene:dnj-2 / 178043 WormBaseID:WBGene00001020 Length:337 Species:Caenorhabditis elegans


Alignment Length:264 Identity:61/264 - (23%)
Similarity:105/264 - (39%) Gaps:57/264 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 NLYDLLGISLES-DQNEIRKAYRKKALECHPD--KNPDNP-KAVERFHELSKALEILTDESARAA 70
            |.||:|.::.|. |:.::.||||..|.:.|||  ||.:.. .|.|||..::.|.|.|.|:.|:..
 Worm    36 NCYDVLEVNREEFDKQKLAKAYRALARKHHPDRVKNKEEKLLAEERFRVIATAYETLKDDEAKTN 100

  Fly    71 YDKVLKAKKAAELRSRQLDGKRQKLKLELE------------ERERAALHKLAKSQPYST-VAKS 122
            ||..|...........|....|...|::|.            .:..:|.||.:::..|:| |.|.
 Worm   101 YDYYLDHPDQRFYNYYQYYRLRAAPKVDLRIVIVGTILIISLFQFLSAKHKFSEAIEYATGVGKF 165

  Fly   123 DEEVLHEQIERLRREGSRLLEEEQRAMQEQFRRNHA--EQQKLQQQPVQ-------------FDS 172
            ....:.:.|::      .|||.::..   :.::|..  ..:.::|..:.             :|:
 Worm   166 RNMAIKDGIDK------GLLEMDRNG---KLKKNKGVDNDEVIKQIIIDNLDVTGGYKRESIYDT 221

  Fly   173 -AQHRI--------KMKWK-------AEPGQDYTQQELLKYLKKYGDVVALVVNSKRRGRAMVEL 221
             |.|.|        .:||.       |...::|.....|..::||..|..:..:.|.....:.:|
 Worm   222 LAWHTIIFPLTIFRYIKWTALWYWRFAIQKEEYDDDAKLYLIRKYIGVSQMEFDQKYTDEDIDDL 286

  Fly   222 ATRE 225
            ..||
 Worm   287 FERE 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17187NP_650056.1 DnaJ 10..72 CDD:278647 25/65 (38%)
RRM_DNAJC17 175..247 CDD:240875 14/66 (21%)
dnj-2NP_502126.1 DnaJ 36..102 CDD:278647 25/65 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160164711
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.