powered by:
Protein Alignment CG17187 and dnj-24
DIOPT Version :9
Sequence 1: | NP_650056.1 |
Gene: | CG17187 / 41351 |
FlyBaseID: | FBgn0037882 |
Length: | 299 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_498155.3 |
Gene: | dnj-24 / 175745 |
WormBaseID: | WBGene00001042 |
Length: | 249 |
Species: | Caenorhabditis elegans |
Alignment Length: | 65 |
Identity: | 32/65 - (49%) |
Similarity: | 45/65 - (69%) |
Gaps: | 3/65 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 12 YDLLGISLESDQNEIRKAYRKKALECHPDKNPDN---PKAVERFHELSKALEILTDESARAAYDK 73
|..||||..||..||:|||||.||:.||||:.|: .:|.::|.::::|.|||||:..||..|:
Worm 9 YITLGISSTSDDVEIKKAYRKLALKWHPDKHTDDKSKEEAEQKFKKIAQAYEILTDKKKRADLDR 73
Fly 74 73
Worm 74 73
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG17187 | NP_650056.1 |
DnaJ |
10..72 |
CDD:278647 |
31/62 (50%) |
RRM_DNAJC17 |
175..247 |
CDD:240875 |
|
dnj-24 | NP_498155.3 |
DnaJ |
9..>111 |
CDD:223560 |
32/65 (49%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.