DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17187 and dnj-18

DIOPT Version :9

Sequence 1:NP_650056.1 Gene:CG17187 / 41351 FlyBaseID:FBgn0037882 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_497962.1 Gene:dnj-18 / 175616 WormBaseID:WBGene00001036 Length:249 Species:Caenorhabditis elegans


Alignment Length:205 Identity:47/205 - (22%)
Similarity:85/205 - (41%) Gaps:31/205 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 YDLLGISLESDQNEIRKAYRKKALECHPDKNPDN-PKAVERFHELSKALEILTDESARAAYDKVL 75
            |.:||::..:.|.:|:.||.|.:.:.|||.||.| .:|.::||:::.|.|||:.|..|.|||...
 Worm    26 YKVLGLAQSASQKDIKSAYYKLSKQHHPDTNPTNKEEAAKKFHQVAMAYEILSSEDKRKAYDMTR 90

  Fly    76 ---------KAKKAAELRSRQLDGKRQKLKLELEERERAALHKLAKSQPY--------------- 116
                     .:..:...|.|.....:|...::::.::.....:..:.:|.               
 Worm    91 IRTSPMPNDPSSFSNRYRRRTSSNLKQYTDIDIDYKDFEHFQRSTRRRPQYHSHFDMPNEFYAEF 155

  Fly   117 ----STVAKSDEEVLHEQIERLRREGSRLLEEEQRAMQEQFRRNHAEQQKLQQQPVQFDSAQHRI 177
                ..|.||:.|...|:...:.::| |..:.|...::.|..|..|..|.....|. |:......
 Worm   156 GGFKKRVFKSEYEEAQEKHGSMYKDG-RAAQREMEELRRQVEREQAAHQARYPIPT-FEQIMRDK 218

  Fly   178 KMKWKAEPGQ 187
            :.|..:|..|
 Worm   219 RAKEASEARQ 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17187NP_650056.1 DnaJ 10..72 CDD:278647 24/60 (40%)
RRM_DNAJC17 175..247 CDD:240875 3/13 (23%)
dnj-18NP_497962.1 PRK14300 23..>181 CDD:172788 35/154 (23%)
DnaJ 23..>88 CDD:223560 25/61 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.