Sequence 1: | NP_650056.1 | Gene: | CG17187 / 41351 | FlyBaseID: | FBgn0037882 | Length: | 299 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_497962.1 | Gene: | dnj-18 / 175616 | WormBaseID: | WBGene00001036 | Length: | 249 | Species: | Caenorhabditis elegans |
Alignment Length: | 205 | Identity: | 47/205 - (22%) |
---|---|---|---|
Similarity: | 85/205 - (41%) | Gaps: | 31/205 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 12 YDLLGISLESDQNEIRKAYRKKALECHPDKNPDN-PKAVERFHELSKALEILTDESARAAYDKVL 75
Fly 76 ---------KAKKAAELRSRQLDGKRQKLKLELEERERAALHKLAKSQPY--------------- 116
Fly 117 ----STVAKSDEEVLHEQIERLRREGSRLLEEEQRAMQEQFRRNHAEQQKLQQQPVQFDSAQHRI 177
Fly 178 KMKWKAEPGQ 187 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG17187 | NP_650056.1 | DnaJ | 10..72 | CDD:278647 | 24/60 (40%) |
RRM_DNAJC17 | 175..247 | CDD:240875 | 3/13 (23%) | ||
dnj-18 | NP_497962.1 | PRK14300 | 23..>181 | CDD:172788 | 35/154 (23%) |
DnaJ | 23..>88 | CDD:223560 | 25/61 (41%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |