DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17187 and dnj-23

DIOPT Version :9

Sequence 1:NP_650056.1 Gene:CG17187 / 41351 FlyBaseID:FBgn0037882 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_495944.1 Gene:dnj-23 / 174451 WormBaseID:WBGene00001041 Length:242 Species:Caenorhabditis elegans


Alignment Length:231 Identity:61/231 - (26%)
Similarity:107/231 - (46%) Gaps:28/231 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LYDLLGISLESDQNEIRKAYRKKALECHPDKN----PDNPKAVERFHELSKALEILTDESARAAY 71
            ||:|||:..:.|:..::|.|.::::..||||:    .|......:|..|:||.:||:||..|..|
 Worm    15 LYELLGVKKDCDEKALKKGYYRQSMRWHPDKSNLVEEDMQTYTTKFQLLNKAYQILSDEEKRKIY 79

  Fly    72 DKVLKA-KKAAELRSRQLDGKRQKLKLELEERERAALHKLAKSQPYSTVAKSDEEVLHEQ----- 130
            |:.... .:|.||....|...|...|...:|    .:....|:...|...| ||.|:|.:     
 Worm    80 DETGSVDDEAGELNEDALKAWRMIFKKVTKE----DIDSFMKTYQGSREQK-DELVVHYEKFNGD 139

  Fly   131 IERLRRE--GSRLLEEEQRAMQEQFRRNHAEQQKLQQQPVQFDSAQHRIKMK-WKAEPGQDYTQQ 192
            |.::|..  |...:||.:.|:.:.......|:.|      :::::....||| :|.:..::..:.
 Worm   140 IAKIREYAIGFDGVEELKEALDKLIDDGEIEKTK------KYETSTSDKKMKAYKRKAEKEAIEV 198

  Fly   193 ELLKYLKKYGDVVALVV-NSKRRGRAMVE-LATREA 226
            |  ...:...|:|||:. ..|.||.:.:: ||.:.|
 Worm   199 E--NMTQNNSDLVALIQGRQKERGTSFLDSLAAKYA 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17187NP_650056.1 DnaJ 10..72 CDD:278647 22/64 (34%)
RRM_DNAJC17 175..247 CDD:240875 15/55 (27%)
dnj-23NP_495944.1 DnaJ 14..80 CDD:365959 22/64 (34%)
CbpA 15..240 CDD:225124 61/231 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2214
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.