DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17187 and dnj-27

DIOPT Version :9

Sequence 1:NP_650056.1 Gene:CG17187 / 41351 FlyBaseID:FBgn0037882 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_001040704.1 Gene:dnj-27 / 173065 WormBaseID:WBGene00001045 Length:788 Species:Caenorhabditis elegans


Alignment Length:401 Identity:87/401 - (21%)
Similarity:145/401 - (36%) Gaps:148/401 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 YDLLGISLESDQNEIRKAYRKKALECHPDKNPDNPKAVERFHELSKALEILTDESARAAYDKVLK 76
            |:|||:..::|...||||::|.|::.|||:|.|:|.|.:.|.:::||.|:|.||:.|..||:.  
 Worm    22 YELLGVERDADDRTIRKAFKKLAIKKHPDRNTDDPNAHDEFVKINKAYEVLKDENLRKKYDQF-- 84

  Fly    77 AKKAAELRSRQLDG-----KRQKLKL------------ELEERERAALHKLAKSQP-------YS 117
            .:|..|      ||     ..|..:.            |:....||...::.....       ||
 Worm    85 GEKGLE------DGFQGGNNYQSWQFYNDNFGIYDDDQEIVTLNRADFQRMVSDSNEIWFINFYS 143

  Fly   118 TVAKSDEEV------LHEQIERLRREGSRLLEEEQRAMQEQ---------------FRRNHAEQQ 161
            |......::      ...:||...|.|:....|:.:..|.|               |.:.|.:.:
 Worm   144 TYCSHCHQLAPTWRKFAREIEGTIRVGAVNCAEDPQLCQSQRVNAYPSLVFYPTGEFYQGHRDVE 208

  Fly   162 KLQQQPVQFDSAQHRIKMK--------WKA-----EP-----------GQDY-------TQQELL 195
                  :..|.|..|:|.:        |||     ||           |.|:       |:::|.
 Worm   209 ------LMVDFAIQRLKSEVLHLNSENWKALSEDWEPYNRLPWVVDMCGGDHIDCLSSTTRRKLS 267

  Fly   196 KYLKKYGDVVALVVNSK-----------------------RRGRAMVE-LATREACDMVLAY--- 233
            ..|....:|..:..|::                       ::.:..:| :..:|....|:.|   
 Worm   268 SMLDGLANVATIDCNAEEALCSKFNPITSGVMWFPARKLVKKSQINIESMDAQEISKSVIQYLDE 332

  Fly   234 -------------EKGDPAKPLHFEWVTPPAADKQTTKS---------ATT-----GCSASSTDY 271
                         |..||.:|:.. |:.  |.|.|:|:.         .||     .||.||...
 Worm   333 LEDISVESLQRLLEGNDPDEPIAV-WML--ANDAQSTERKDFRRLPALVTTQIFKFDCSKSSEIC 394

  Fly   272 EDLVMR-KLRQ 281
            ::|:.: ||.|
 Worm   395 DELLDKTKLPQ 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17187NP_650056.1 DnaJ 10..72 CDD:278647 26/59 (44%)
RRM_DNAJC17 175..247 CDD:240875 22/142 (15%)
dnj-27NP_001040704.1 DnaJ 18..>150 CDD:223560 39/135 (29%)
DnaJ 20..82 CDD:278647 26/59 (44%)
PDI_a_ERdj5_N 116..214 CDD:239301 16/103 (16%)
Thioredoxin_like 222..>312 CDD:294274 12/89 (13%)
ER_PDI_fam 438..750 CDD:273457
PDI_a_ERdj5_C 438..543 CDD:239302
PDI_a_ERdj5_C 549..664 CDD:239302
PDI_a_ERdj5_C 670..773 CDD:239302
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.