DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17187 and AgaP_AGAP001810

DIOPT Version :9

Sequence 1:NP_650056.1 Gene:CG17187 / 41351 FlyBaseID:FBgn0037882 Length:299 Species:Drosophila melanogaster
Sequence 2:XP_321247.5 Gene:AgaP_AGAP001810 / 1281303 VectorBaseID:AGAP001810 Length:362 Species:Anopheles gambiae


Alignment Length:162 Identity:47/162 - (29%)
Similarity:74/162 - (45%) Gaps:28/162 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KKYSDVNLYDLLGISLESDQNEIRKAYRKKALECHPDKNPDNPKAVERFHELSKALEILTDESAR 68
            ||..|  .|::||::.::..::|:|||:|.||:.||||| ..|.|||.|..:..|:.||||...|
Mosquito   100 KKCKD--YYEVLGVAKDATDSDIKKAYKKLALQLHPDKN-HAPGAVEAFKAIGNAVAILTDAEKR 161

  Fly    69 AAYDKVLKAKKAAELRSRQLDGKRQKLKLELEERERAALHKLAKSQPYSTVAKSDEEVLHEQIER 133
            .:||               |.|..       |..:.|...|......|:.....:.|...|::..
Mosquito   162 RSYD---------------LYGSE-------EHHQPATARKARYHHDYAYSRGFETEFTAEELFN 204

  Fly   134 LRREGSRLLEEEQRAMQEQFRRNHAEQQKLQQ 165
            : ..|:.:..:.....|.:|.|  ||||:.::
Mosquito   205 M-FFGAEINTQHVYTRQRRFHR--AEQQQYRE 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17187NP_650056.1 DnaJ 10..72 CDD:278647 26/61 (43%)
RRM_DNAJC17 175..247 CDD:240875
AgaP_AGAP001810XP_321247.5 DnaJ 103..>222 CDD:223560 39/144 (27%)
DnaJ 104..165 CDD:278647 27/63 (43%)
DUF1977 262..359 CDD:286411
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.