DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17187 and AgaP_AGAP000831

DIOPT Version :9

Sequence 1:NP_650056.1 Gene:CG17187 / 41351 FlyBaseID:FBgn0037882 Length:299 Species:Drosophila melanogaster
Sequence 2:XP_316797.3 Gene:AgaP_AGAP000831 / 1277341 VectorBaseID:AGAP000831 Length:341 Species:Anopheles gambiae


Alignment Length:249 Identity:58/249 - (23%)
Similarity:105/249 - (42%) Gaps:58/249 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 NLYDLLGISLESDQNEIRKAYRKKALECHPD--KNPDNPKAVER-FHELSKALEILTDESARAAY 71
            |.|:|||:|.||.:.||.|:||:.|.:.|||  ..|:..:|.|. |..::.|.|:|.||.:|..|
Mosquito    36 NCYELLGVSRESTKQEIAKSYRQLARKYHPDLHHGPEQKQAAEESFKRIATAYEVLKDEESRNDY 100

  Fly    72 DKVLKAKKAAELRSRQLDGKRQKLKLEL----EERERAALHKLAKSQPYSTVAK---SDEEVLHE 129
            :.:|...:|......:...::.|:.:.|    .....:.:..:.:.|.|.|..|   |..:..::
Mosquito   101 NYLLDNPQAYYAHFYRYYRRKAKIDVRLVIVVTISIISCIQYVTRWQRYDTAIKYFMSLPKYRNK 165

  Fly   130 QIERLRRE--------GS------RLLEEEQRAMQEQFRRNHAEQ-QKLQQQPVQFDSAQHRIKM 179
            .:|.:.:.        ||      :|.:.||       |:.|.|| :|:.:..:....|..:.::
Mosquito   166 AMEMINQSNGGGGGGGGSGKQGRIKLSKAEQ-------RKEHDEQIRKVIENNMDIQGAYAKPEI 223

  Fly   180 K-------------------------WK-AEPGQDYTQQELLKYLKKYGDVVAL 207
            |                         || ....|.|.::|.|..:::|..:.|:
Mosquito   224 KDILWIQLFLLPYTVGRYLWWAGRWVWKFTLLKQPYGREEQLYLIRRYMRLTAV 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17187NP_650056.1 DnaJ 10..72 CDD:278647 27/64 (42%)
RRM_DNAJC17 175..247 CDD:240875 9/59 (15%)
AgaP_AGAP000831XP_316797.3 DnaJ 36..101 CDD:278647 27/64 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.