DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17187 and AgaP_AGAP004849

DIOPT Version :9

Sequence 1:NP_650056.1 Gene:CG17187 / 41351 FlyBaseID:FBgn0037882 Length:299 Species:Drosophila melanogaster
Sequence 2:XP_314342.3 Gene:AgaP_AGAP004849 / 1275118 VectorBaseID:AGAP004849 Length:284 Species:Anopheles gambiae


Alignment Length:233 Identity:57/233 - (24%)
Similarity:102/233 - (43%) Gaps:40/233 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MASKKYSDVNLYDLLGISLESDQNEIRKAYRKKALECHPDKNPDNPK--AVERFHELSKALEILT 63
            :..|.|...|:|:|.|:...:...||:|||.:.:|:.|||:.|::.|  |.|:|..|||...||:
Mosquito     6 VCEKYYGTKNIYELFGVEKSASDQEIKKAYYRLSLQTHPDRVPESDKQEATEKFKVLSKLYNILS 70

  Fly    64 DESARAAYDK---VLKAKKAA------------ELRSRQLDGKRQKL---KLELEERERAALH-K 109
            ::.:||.||:   |.....|:            .|.:..:|..::..   :.|..:.:||.|. |
Mosquito    71 NKDSRAIYDERGTVDDDDNASTNWLARWQQFFKPLTTEDIDNYQKSYVGSETERNDIKRAYLRGK 135

  Fly   110 LAKSQPYSTV--AKSDEE-----VLHEQIERLRREGSRLLEEEQRAMQEQFRRNHAEQQKLQQQP 167
            ..|:....||  .:.::|     ::.|.|:.......::...|..|.::|..:.:|.:.|:..| 
Mosquito   136 GCKNSMMCTVPFMQCEDEPRIAAIVQEMIDSKEVPEYKIFTNEPEAKRKQRHKKYAREAKMASQ- 199

  Fly   168 VQFDSAQHRIKMKWKAEPGQDYTQQELLKYLKKYGDVV 205
                       ||.|.:......||..||....:..::
Mosquito   200 -----------MKKKQDDTSSLEQQIALKRKSAFSSLI 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17187NP_650056.1 DnaJ 10..72 CDD:278647 25/63 (40%)
RRM_DNAJC17 175..247 CDD:240875 7/31 (23%)
AgaP_AGAP004849XP_314342.3 CbpA 13..223 CDD:225124 55/221 (25%)
DnaJ 17..79 CDD:278647 24/61 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2214
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.