DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17187 and AgaP_AGAP010432

DIOPT Version :9

Sequence 1:NP_650056.1 Gene:CG17187 / 41351 FlyBaseID:FBgn0037882 Length:299 Species:Drosophila melanogaster
Sequence 2:XP_311513.4 Gene:AgaP_AGAP010432 / 1272561 VectorBaseID:AGAP010432 Length:574 Species:Anopheles gambiae


Alignment Length:149 Identity:45/149 - (30%)
Similarity:64/149 - (42%) Gaps:39/149 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 YSDVNLYDLLGISLESDQNEIRKAYRKKALECHPDK--NPDNPKAVE-RFHELSKALEILTDESA 67
            |.:.:.|..|.:...:.|.||.||||..:...||||  |.:|.:..| .|:...||.|:|:|...
Mosquito     9 YVEQDYYATLNLPRSATQEEISKAYRNLSKIFHPDKHGNGENKQKAELMFNRTKKAYEVLSDPHQ 73

  Fly    68 RAAYDKVLKAKKAAELRSRQLDGKRQKLKLELEERERAALHKLAKSQPYSTVAKSDEEVLHEQIE 132
            ||.||            |..:.|      ||.|..|  .:|:          .|:..|: .|:.|
Mosquito    74 RAIYD------------SLGVKG------LETEGWE--IVHR----------TKTPNEI-REEYE 107

  Fly   133 RLRREGSRLLEEEQRAMQE 151
            ||.:|     .||:|..|:
Mosquito   108 RLAQE-----REERRLQQK 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17187NP_650056.1 DnaJ 10..72 CDD:278647 24/64 (38%)
RRM_DNAJC17 175..247 CDD:240875
AgaP_AGAP010432XP_311513.4 DnaJ 11..>89 CDD:223560 30/95 (32%)
DnaJ 13..78 CDD:278647 24/64 (38%)
DUF3395 410..548 CDD:288708
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.