DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17187 and AgaP_AGAP000970

DIOPT Version :9

Sequence 1:NP_650056.1 Gene:CG17187 / 41351 FlyBaseID:FBgn0037882 Length:299 Species:Drosophila melanogaster
Sequence 2:XP_309163.1 Gene:AgaP_AGAP000970 / 1270465 VectorBaseID:AGAP000970 Length:186 Species:Anopheles gambiae


Alignment Length:70 Identity:28/70 - (40%)
Similarity:43/70 - (61%) Gaps:0/70 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KKYSDVNLYDLLGISLESDQNEIRKAYRKKALECHPDKNPDNPKAVERFHELSKALEILTDESAR 68
            |:.|..:||.||..|..|..::|:..::..||:.|||||..:.::..:|.:|.:|.|||.|...|
Mosquito    11 KRDSKEDLYALLNCSETSTVDQIQAEFKILALQYHPDKNDGDKESEAKFQQLKEAKEILCDPEKR 75

  Fly    69 AAYDK 73
            |:|||
Mosquito    76 ASYDK 80

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17187NP_650056.1 DnaJ 10..72 CDD:278647 23/61 (38%)
RRM_DNAJC17 175..247 CDD:240875
AgaP_AGAP000970XP_309163.1 DnaJ 17..79 CDD:278647 23/61 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2214
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.