powered by:
Protein Alignment CG17187 and AgaP_AGAP000970
DIOPT Version :9
Sequence 1: | NP_650056.1 |
Gene: | CG17187 / 41351 |
FlyBaseID: | FBgn0037882 |
Length: | 299 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_309163.1 |
Gene: | AgaP_AGAP000970 / 1270465 |
VectorBaseID: | AGAP000970 |
Length: | 186 |
Species: | Anopheles gambiae |
Alignment Length: | 70 |
Identity: | 28/70 - (40%) |
Similarity: | 43/70 - (61%) |
Gaps: | 0/70 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 4 KKYSDVNLYDLLGISLESDQNEIRKAYRKKALECHPDKNPDNPKAVERFHELSKALEILTDESAR 68
|:.|..:||.||..|..|..::|:..::..||:.|||||..:.::..:|.:|.:|.|||.|...|
Mosquito 11 KRDSKEDLYALLNCSETSTVDQIQAEFKILALQYHPDKNDGDKESEAKFQQLKEAKEILCDPEKR 75
Fly 69 AAYDK 73
|:|||
Mosquito 76 ASYDK 80
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG17187 | NP_650056.1 |
DnaJ |
10..72 |
CDD:278647 |
23/61 (38%) |
RRM_DNAJC17 |
175..247 |
CDD:240875 |
|
AgaP_AGAP000970 | XP_309163.1 |
DnaJ |
17..79 |
CDD:278647 |
23/61 (38%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG2214 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.