DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17187 and AgaP_AGAP007107

DIOPT Version :9

Sequence 1:NP_650056.1 Gene:CG17187 / 41351 FlyBaseID:FBgn0037882 Length:299 Species:Drosophila melanogaster
Sequence 2:XP_308650.4 Gene:AgaP_AGAP007107 / 1269995 VectorBaseID:AGAP007107 Length:351 Species:Anopheles gambiae


Alignment Length:309 Identity:73/309 - (23%)
Similarity:124/309 - (40%) Gaps:73/309 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 NLYDLLGISLESDQNEIRKAYRKKALECHPDKNPDNPKAVERFHELSKALEILTDESARAAYDKV 74
            :.|.:||:|..:..:||:|||||.||:.||||| ..|:|.|||.|:::|.|:|:|:..|..||:.
Mosquito     4 DFYKILGVSKNASDDEIKKAYRKLALKYHPDKN-KAPQAEERFKEVAEAYEVLSDKKKRDIYDQY 67

  Fly    75 -LKAKKAAELRSRQLDGKRQKLKLELEERERAALHK-LAKSQPYSTVAKSD--EEVLHEQIE--- 132
             .:..|..........|:..:.:.......||...: ...|.|:|....:|  ..:.|::::   
Mosquito    68 GEEGLKGGAGGMPGAGGQSGQFQYNFHGDPRATFAQFFGTSDPFSVFFGTDGGGNIFHQEMDGDP 132

  Fly   133 -RLRREGSRLLEEEQRAMQEQFRRNHA---EQQKLQQQPVQFD----------SAQHRIKMKWKA 183
             .....|..:......|.:.|....|.   .:||||..|::.|          ..|.::|:. |.
Mosquito   133 FGFDGRGGSVGGFPGGAFRSQSFNVHGSPQRKQKLQDPPIEHDLYVSLEDVNAGCQKKMKIS-KM 196

  Fly   184 EPGQDYT---QQELLKYLKKYG----------------------DVVALV-----VNSKRRG--- 215
            ..|||.:   ::::|....|.|                      |:|.::     .:.||.|   
Mosquito   197 VMGQDGSARKEEKILSINVKPGWKAGTKITFPREGDQIPGKVPADIVFIIRDKPHAHFKREGSDI 261

  Fly   216 RAMVELATREA-CDMVLAYEKGDPAKPLHFEWVTPPAADKQTTKSATTG 263
            :...:::.|:| |..|                |..|....:|...:|.|
Mosquito   262 KYTAKISLRQALCGTV----------------VKVPTLSGETLTISTAG 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17187NP_650056.1 DnaJ 10..72 CDD:278647 29/61 (48%)
RRM_DNAJC17 175..247 CDD:240875 17/105 (16%)
AgaP_AGAP007107XP_308650.4 DnaJ 1..347 CDD:223560 73/309 (24%)
DnaJ 4..65 CDD:278647 29/61 (48%)
DnaJ_C 170..332 CDD:199909 25/142 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.