DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17187 and Dnajc9

DIOPT Version :9

Sequence 1:NP_650056.1 Gene:CG17187 / 41351 FlyBaseID:FBgn0037882 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_598842.1 Gene:Dnajc9 / 108671 MGIID:1915326 Length:259 Species:Mus musculus


Alignment Length:264 Identity:55/264 - (20%)
Similarity:110/264 - (41%) Gaps:47/264 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MASKKYSDVNLYDLLGISLESDQNEIRKAYRKKALECHPDKNPDNPK--AVERFHELSKALEILT 63
            :..:.:...:||.:||:..|:...|:|:.|.|.:|:.|||:..::.|  |..||..|.:...:|:
Mouse     6 LCEQVFGTADLYQVLGVRREASDGEVRRGYHKVSLQVHPDRVEEDQKEDATRRFQILGRVYAVLS 70

  Fly    64 DESARAAYDK--VLKAKKAAELRSRQLDGKRQKL--KLELEERERAALHKLAK---------SQP 115
            |:..:|.||:  .:....|...:.|..|...:.|  |:.||:.:  |..|..|         .|.
Mouse    71 DKEQKAVYDEQGTVDEDSAGLNQDRDWDAYWRLLFKKISLEDIQ--AFEKTYKGSEEELNDIKQA 133

  Fly   116 YSTVAKSDEEVLHEQI--------ERLRREGSRLLEEEQRAMQEQFRRNHAEQQKLQQQPVQFDS 172
            |... |.|.:.:.|.:        .|:|....:.:|.::......|.:...::...:::..|.::
Mouse   134 YLDF-KGDMDQIMESVLCVQYTDEPRIRNIIQKAIESKEIPAYSAFVKESKQKMNARKRRAQEEA 197

  Fly   173 AQHRIKMKWKAEPGQDYTQQELLKYLKKYGDVVALVVNSKRRGRAMVELATREACDMVLAYEKGD 237
            .:..:..|   |.|           |::..|.:..::.|:::.|       ::..|..||..:..
Mouse   198 KEAELSRK---ELG-----------LEEGVDNLKALIQSRQKDR-------QKEMDSFLAQMEAK 241

  Fly   238 PAKP 241
            ..||
Mouse   242 YCKP 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17187NP_650056.1 DnaJ 10..72 CDD:278647 21/63 (33%)
RRM_DNAJC17 175..247 CDD:240875 12/67 (18%)
Dnajc9NP_598842.1 DnaJ 15..79 CDD:278647 21/63 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2214
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.