DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17187 and dnajc25

DIOPT Version :9

Sequence 1:NP_650056.1 Gene:CG17187 / 41351 FlyBaseID:FBgn0037882 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_001191956.1 Gene:dnajc25 / 100319235 ZFINID:ZDB-GENE-081104-137 Length:344 Species:Danio rerio


Alignment Length:237 Identity:58/237 - (24%)
Similarity:100/237 - (42%) Gaps:49/237 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 YDLLGISLESDQNEIRKAYRKKALECHPDK------NPDNPKAVERFHELSKALEILTDESARAA 70
            ||:||:|.:..:.|:.:|||:.|...|||:      :.....|.::|..::.|.|.|.||..|..
Zfish    39 YDVLGVSRDVSKAELGRAYRQLARRYHPDRFQPGETDDTQESAQQKFLLVATAYETLKDEELRKD 103

  Fly    71 YDKVLKAKKAAELRSRQLDGKRQKL--KLELEERERAALHKLAKSQPYS-------------TVA 120
            ||.:|...:  |..|......|::|  |:::.......:..::..|.||             ||.
Zfish   104 YDYMLDHPE--EYYSHYYTYYRRRLAPKVDVRIVILVTICAISLFQYYSWWSSYTEAINYLMTVP 166

  Fly   121 K---SDEEVLHEQ--IERLRREG-SRLLEEEQRAMQEQFRR----NHAEQQKLQQQPVQFDSAQH 175
            |   ...|:..:|  :.|.:.:| :|..:||.|..:||..|    |..:.:...|:|...|....
Zfish   167 KYRIQATELAKQQGLLNRTKEKGKNRRSKEEIREEEEQIIRDIIKNKIDIKGGYQKPNVSDILLC 231

  Fly   176 RIKM---------KWKAE-------PGQDYTQQELLKYLKKY 201
            :|.:         .|...       .|::|.::|.|..::||
Zfish   232 KIVLFPYHLCTYVAWNFSWFYRFTIRGEEYGEEERLYIIRKY 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17187NP_650056.1 DnaJ 10..72 CDD:278647 21/65 (32%)
RRM_DNAJC17 175..247 CDD:240875 8/43 (19%)
dnajc25NP_001191956.1 DnaJ 37..105 CDD:278647 21/65 (32%)
DnaJ 39..>113 CDD:223560 24/75 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.