DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scpr-C and Pi15

DIOPT Version :9

Sequence 1:NP_001287282.1 Gene:scpr-C / 41348 FlyBaseID:FBgn0037879 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_444421.2 Gene:Pi15 / 94227 MGIID:1934659 Length:269 Species:Mus musculus


Alignment Length:279 Identity:65/279 - (23%)
Similarity:103/279 - (36%) Gaps:67/279 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAIKSLILLTSLLGISLAADYCALPTCLDKHIACNNKGNF---------SENCPKDVREVKIEPH 56
            |.:.|.:.|..||.:...|....|....|..:..||..:.         |.:.||..|:..|..:
Mouse    12 MIMNSAVSLVILLSLLCEAHTVVLLNPTDSSLPANNFTDTEAALSTPLESADIPKARRKRYISQN 76

  Fly    57 HKL-ILNLFNELRNNVAGGKIEGLPKAVRMAKMSWCEELSHLALLNVKTCESLPDKC----RSTE 116
            ..: ||:..|::|     ||:  .|.|..|..|.|.|.|:       |:.|:....|    ..:.
Mouse    77 DMIAILDYHNQVR-----GKV--FPPAANMEYMVWDENLA-------KSAEAWAATCIWDHGPSY 127

  Fly   117 RFAYAGQNNAVFQYSGAETEYTDAEIIKEQIENWFAE-RSNASPEILASFPEELPNKA------- 173
            ...:.|||.:|     ....|..   |.:.::.|:.| :..|.|     :|::...:.       
Mouse   128 LLRFLGQNLSV-----RTGRYRS---ILQLVKPWYDEVKDYAFP-----YPQDCNPRCPMRCFGP 179

  Fly   174 -VTKFTIAVAEKNTHVGCA----------AVRFSRDFYNHFVLTCNFA-TSNIVGQPVYTPGEKA 226
             .|.:|..|...:..:|||          ...:.|..|    |.||:| ..|.:|:..|..|...
Mouse   180 MCTHYTQMVWATSNRIGCAIHTCQNMNVWGSVWRRAVY----LVCNYAPKGNWIGEAPYKVGVPC 240

  Fly   227 TTGCKNRYGAAYDYPNLCY 245
            :: |...||.|.. .|||:
Mouse   241 SS-CPPSYGGACT-DNLCF 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scpr-CNP_001287282.1 SCP_euk 58..210 CDD:240180 38/175 (22%)
Pi15NP_444421.2 SCP_euk 80..223 CDD:240180 38/173 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841272
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 75 1.000 Inparanoid score I5254
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.900

Return to query results.
Submit another query.