powered by:
Protein Alignment scpr-C and PRY2
DIOPT Version :9
Sequence 1: | NP_001287282.1 |
Gene: | scpr-C / 41348 |
FlyBaseID: | FBgn0037879 |
Length: | 262 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_012938.3 |
Gene: | PRY2 / 853882 |
SGDID: | S000001721 |
Length: | 329 |
Species: | Saccharomyces cerevisiae |
Alignment Length: | 74 |
Identity: | 14/74 - (18%) |
Similarity: | 34/74 - (45%) |
Gaps: | 13/74 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 147 IENWFAERSNASPEILASFPEELP--NKAVTKFTIAVAEKNTHVGCAAVRFSRDFYNHFVLTCNF 209
::.|:.| :.|:....| :::...||..|.:..:.|||.......::.::.: |::
Yeast 257 VDAWYNE--------ITSYDYSNPGFSESAGHFTQVVWKGTSEVGCGLKSCGGEWGDYII--CSY 311
Fly 210 -ATSNIVGQ 217
|..|::|:
Yeast 312 KAAGNVIGE 320
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C157344555 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG2340 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.740 |
|
Return to query results.
Submit another query.