DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scpr-C and PRY2

DIOPT Version :9

Sequence 1:NP_001287282.1 Gene:scpr-C / 41348 FlyBaseID:FBgn0037879 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_012938.3 Gene:PRY2 / 853882 SGDID:S000001721 Length:329 Species:Saccharomyces cerevisiae


Alignment Length:74 Identity:14/74 - (18%)
Similarity:34/74 - (45%) Gaps:13/74 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 IENWFAERSNASPEILASFPEELP--NKAVTKFTIAVAEKNTHVGCAAVRFSRDFYNHFVLTCNF 209
            ::.|:.|        :.|:....|  :::...||..|.:..:.|||.......::.::.:  |::
Yeast   257 VDAWYNE--------ITSYDYSNPGFSESAGHFTQVVWKGTSEVGCGLKSCGGEWGDYII--CSY 311

  Fly   210 -ATSNIVGQ 217
             |..|::|:
Yeast   312 KAAGNVIGE 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scpr-CNP_001287282.1 SCP_euk 58..210 CDD:240180 11/65 (17%)
PRY2NP_012938.3 CAP_PRY1-like 191..319 CDD:349403 13/71 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157344555
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.