DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scpr-C and CRISPLD2

DIOPT Version :9

Sequence 1:NP_001287282.1 Gene:scpr-C / 41348 FlyBaseID:FBgn0037879 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_113664.1 Gene:CRISPLD2 / 83716 HGNCID:25248 Length:497 Species:Homo sapiens


Alignment Length:220 Identity:57/220 - (25%)
Similarity:78/220 - (35%) Gaps:50/220 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 REVKIEPHHKLILNLFNELRNNVAGGKIEGLPKAVRMAKMSWCEELSHLALLNVKTC--ESLPDK 111
            ||.|.|     ||.|.|:||..|.       |:|..|..|:|.:||...|......|  |..|  
Human    53 REDKEE-----ILMLHNKLRGQVQ-------PQASNMEYMTWDDELEKSAAAWASQCIWEHGP-- 103

  Fly   112 CRSTERFAYAGQNNAVFQYSGAE-TEYTDAEIIKEQIENWFAE--------RSNASPEILASFPE 167
               |......|||      .||. ..|.....   .:::|:.|        .|..:|..    ||
Human   104 ---TSLLVSIGQN------LGAHWGRYRSPGF---HVQSWYDEVKDYTYPYPSECNPWC----PE 152

  Fly   168 ELPNKAVTKFTIAVAEKNTHVGCAA------VRFSRDFYNHFVLTCNFA-TSNIVGQPVYTPGEK 225
            .......|.:|..|......:|||.      ..:...:.|.....||:: ..|.:|:..|..| :
Human   153 RCSGPMCTHYTQIVWATTNKIGCAVNTCRKMTVWGEVWENAVYFVCNYSPKGNWIGEAPYKNG-R 216

  Fly   226 ATTGCKNRYGAAYDYPNLCYAKEIY 250
            ..:.|...||.:. ..||||.:|.|
Human   217 PCSECPPSYGGSC-RNNLCYREETY 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scpr-CNP_001287282.1 SCP_euk 58..210 CDD:240180 40/168 (24%)
CRISPLD2NP_113664.1 SCP_euk 56..201 CDD:240180 42/174 (24%)
LCCL 286..370 CDD:128866
LCCL 387..479 CDD:128866
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151216
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.