DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scpr-C and AT4G33730

DIOPT Version :10

Sequence 1:NP_650053.1 Gene:scpr-C / 41348 FlyBaseID:FBgn0037879 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_195099.1 Gene:AT4G33730 / 829515 AraportID:AT4G33730 Length:172 Species:Arabidopsis thaliana


Alignment Length:45 Identity:9/45 - (20%)
Similarity:18/45 - (40%) Gaps:4/45 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   177 FTIAVAEKNTHVGCAAVRFSRDFYNHFVLTCNF-ATSNIVGQPVY 220
            :|..|...:..:||...:.:.   ...::.||: ...|.:|...|
plant   131 YTQVVWRGSARLGCGKAKCNN---GASIVVCNYDPAGNYIGARPY 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scpr-CNP_650053.1 CAP_euk 57..210 CDD:349399 6/33 (18%)
AT4G33730NP_195099.1 CAP_PR-1 39..172 CDD:349400 8/43 (19%)

Return to query results.
Submit another query.