DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scpr-C and AT3G19690

DIOPT Version :9

Sequence 1:NP_001287282.1 Gene:scpr-C / 41348 FlyBaseID:FBgn0037879 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_188603.1 Gene:AT3G19690 / 821506 AraportID:AT3G19690 Length:161 Species:Arabidopsis thaliana


Alignment Length:193 Identity:43/193 - (22%)
Similarity:65/193 - (33%) Gaps:66/193 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 FSENCPKDVREVKIEPHHKLILNLFNELRNNVAGGKIEGLPKAVRMAKMSWCEELSHLALLNVKT 104
            |..:..:|:::..:|.|        ||.||.|      ||...|      |.:|::..|.     
plant    17 FYGSLAEDLQQQFLEAH--------NEARNEV------GLDPLV------WDDEVAAYAA----- 56

  Fly   105 CESLPDKCRSTERFAYAGQ--NNAVFQYS----GAETEYTDAEIIKEQ-IENWFAER------SN 156
                          :||.|  |:....:|    |.....:..|:..|. .|.|..|:      ||
plant    57 --------------SYANQRINDCALVHSNGPFGENIAMSSGEMSAEDAAEMWINEKQYYDYDSN 107

  Fly   157 ASPEILASFPEELPNKAVTKFTIAVAEKNT-HVGCAAVRFSRDFYNHFVLTCNF-ATSNIVGQ 217
            ...:         ||.........|..||| .:|||.|..:.   ....:|||: ...|.:|:
plant   108 TCND---------PNGGTCLHYTQVVWKNTVRLGCAKVVCNS---GGTFITCNYDPPGNYIGE 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scpr-CNP_001287282.1 SCP_euk 58..210 CDD:240180 37/166 (22%)
AT3G19690NP_188603.1 CAP_PR-1 26..161 CDD:349400 41/184 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.