DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scpr-C and PR-1-LIKE

DIOPT Version :9

Sequence 1:NP_001287282.1 Gene:scpr-C / 41348 FlyBaseID:FBgn0037879 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_179589.1 Gene:PR-1-LIKE / 816518 AraportID:AT2G19990 Length:176 Species:Arabidopsis thaliana


Alignment Length:184 Identity:40/184 - (21%)
Similarity:62/184 - (33%) Gaps:47/184 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 PKDVREVKIEPHHKLILNLFNELRNNVAGGKIEGLPKAVRMAKMSWCEELSHLALLNVKTCESLP 109
            ||......::|...|:::  |:.|..|..|            .|.|.|.|:..|       :|..
plant    32 PKANANGDVKPQETLVVH--NKARAMVGVG------------PMVWNETLATYA-------QSYA 75

  Fly   110 DK----CRSTERFAYAGQNNAV--FQYSG-AETEYTDAEIIKEQIENWFAERSNASPEILASFPE 167
            .:    |.........|:|.|.  ...|| ..|||            |..|:.|...:......:
plant    76 HERARDCAMKHSLGPFGENLAAGWGTMSGPVATEY------------WMTEKENYDYDSNTCGGD 128

  Fly   168 ELPNKAVTKFTIAVAEKNTHVGCAAVRFSRDFYNHFVLTCNF-ATSNIVGQPVY 220
            .:    ...:|..|...:..:|||:||...|.|  ..:.|:: ...|.:||..|
plant   129 GV----CGHYTQIVWRDSVRLGCASVRCKNDEY--IWVICSYDPPGNYIGQRPY 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scpr-CNP_001287282.1 SCP_euk 58..210 CDD:240180 33/159 (21%)
PR-1-LIKENP_179589.1 CAP_PR-1 42..176 CDD:349400 37/172 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.