DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scpr-C and PRB1

DIOPT Version :9

Sequence 1:NP_001287282.1 Gene:scpr-C / 41348 FlyBaseID:FBgn0037879 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_179064.1 Gene:PRB1 / 815945 AraportID:AT2G14580 Length:161 Species:Arabidopsis thaliana


Alignment Length:171 Identity:35/171 - (20%)
Similarity:58/171 - (33%) Gaps:34/171 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 VKIEPHHKLILNLFNELRNNVAGGKIEGLPKAVRMAKMSWCEELSHLALLNVKTCESLPDKCRST 115
            :|.:...:..:|..|:.|:.:..|            .|.|.|.|:..|.   .....|...||..
plant    24 LKAQDSQQDYVNAHNQARSQIGVG------------PMQWDEGLAAYAR---NYANQLKGDCRLV 73

  Fly   116 ERFAYAGQNNAVFQYSGAETEYTDAEIIKEQIENWFAERSNASPEILASFPEELPNKAVTKFTIA 180
            ......|:|.|   .||.:.....|      :..|..|::|      .::.....|.....:|..
plant    74 HSRGPYGENLA---KSGGDLSGVAA------VNLWVNEKAN------YNYDTNTCNGVCGHYTQV 123

  Fly   181 VAEKNTHVGCAAVRFSRDFYNHFVLTCNF-ATSNIVGQPVY 220
            |...:..:|||.||.:.   ...:::||: ...|...|..|
plant   124 VWRNSVRLGCAKVRCNN---GGTIISCNYDPPGNYANQKPY 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scpr-CNP_001287282.1 SCP_euk 58..210 CDD:240180 31/152 (20%)
PRB1NP_179064.1 CAP_PR-1 30..161 CDD:349400 33/163 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.