DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scpr-C and CRISP2

DIOPT Version :9

Sequence 1:NP_001287282.1 Gene:scpr-C / 41348 FlyBaseID:FBgn0037879 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_005249406.1 Gene:CRISP2 / 7180 HGNCID:12024 Length:278 Species:Homo sapiens


Alignment Length:198 Identity:45/198 - (22%)
Similarity:76/198 - (38%) Gaps:56/198 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAIKSLILLTSLLGISLAAD-----YCALPTCLDKHIACNNKGNFSENCPKDVREVKIEPHHKLI 60
            ||:..::.|.::|..||.|:     :.||.|                      .:::::   :.|
Human     1 MALLPVLFLVTVLLPSLPAEGKDPAFTALLT----------------------TQLQVQ---REI 40

  Fly    61 LNLFNELRNNVAGGKIEGLPKAVRMAKMSWCEELSHLALLNVKTC---ESLPDKCRSTERFAYAG 122
            :|..||||..|:       |.|..|.||.|..|::..|......|   .|.|:..:::.|   .|
Human    41 VNKHNELRKAVS-------PPASNMLKMEWSREVTTNAQRWANKCTLQHSDPEDRKTSTR---CG 95

  Fly   123 QNNAVFQYSGAETEYTDAEIIKEQIENWFAERSNASPEILASFPEELPNKAVTKFTIAVAEKNTH 187
            :|   ...|...|.::.|      |::|:.|    ..:.:.....:.||..|..:|..|......
Human    96 EN---LYMSSDPTSWSSA------IQSWYDE----ILDFVYGVGPKSPNAVVGHYTQLVWYSTYQ 147

  Fly   188 VGC 190
            |||
Human   148 VGC 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scpr-CNP_001287282.1 SCP_euk 58..210 CDD:240180 35/136 (26%)
CRISP2XP_005249406.1 SCP_CRISP 35..172 CDD:240183 35/142 (25%)
Crisp 224..278 CDD:285731
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151279
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.