DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scpr-C and crisp1.3

DIOPT Version :9

Sequence 1:NP_001287282.1 Gene:scpr-C / 41348 FlyBaseID:FBgn0037879 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001008204.1 Gene:crisp1.3 / 493566 XenbaseID:XB-GENE-951048 Length:240 Species:Xenopus tropicalis


Alignment Length:209 Identity:45/209 - (21%)
Similarity:79/209 - (37%) Gaps:43/209 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 KLILNLFNELRNNVAGGKIEGLPKAVRMAKMSWCEELSHLALLNVKTCES--LPDKCRSTERFAY 120
            ::|:|..|..|.|.:       |.|..|.||.|.::.:..|.....||..  .|...|:...|. 
 Frog    36 QIIINAHNNYRRNAS-------PSARNMLKMVWNKDAAINAASWAATCSESHSPSDKRTIPGFG- 92

  Fly   121 AGQNNAVFQYSGAETEYTDAEIIKEQIENWFAERSN----ASPEILASFPEELPNKAVTKFTIAV 181
            .|:|..:..|..:         .:|.::.|::|.::    ..|        :.|......:|..:
 Frog    93 CGENLYMASYPAS---------WEEAVKGWYSEYNDFQYGVGP--------KSPGLVTGHYTQVM 140

  Fly   182 AEKNTHVGCAAVRFSRDFYNHFVLTCNFATSNIVGQPVYTP---GEKAT---TGCKNRYGAAYDY 240
            ...:..|||:.....:..|.:|.: |.:..:..:...:.||   |.|..   |.|.|  |...:|
 Frog   141 WYNSYMVGCSVSYCPKSPYKYFYV-CQYCPAGNLDSTMSTPYKTGPKCADCPTACDN--GLCTNY 202

  Fly   241 PNLCYAKEIYDNEK 254
               |..:::|.|.|
 Frog   203 ---CPYQDLYSNCK 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scpr-CNP_001287282.1 SCP_euk 58..210 CDD:240180 32/157 (20%)
crisp1.3NP_001008204.1 CAP_CRISP 33..170 CDD:349402 32/159 (20%)
Crisp 187..240 CDD:369954 9/32 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.