DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scpr-C and scpr-B

DIOPT Version :9

Sequence 1:NP_001287282.1 Gene:scpr-C / 41348 FlyBaseID:FBgn0037879 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_650061.1 Gene:scpr-B / 41357 FlyBaseID:FBgn0037888 Length:262 Species:Drosophila melanogaster


Alignment Length:262 Identity:260/262 - (99%)
Similarity:261/262 - (99%) Gaps:0/262 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAIKSLILLTSLLGISLAADYCALPTCLDKHIACNNKGNFSENCPKDVREVKIEPHHKLILNLFN 65
            ||||.||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Fly     1 MAIKCLILLTSLLGISLAADYCALPTCLDKHIACNNKGNFSENCPKDVREVKIEPHHKLILNLFN 65

  Fly    66 ELRNNVAGGKIEGLPKAVRMAKMSWCEELSHLALLNVKTCESLPDKCRSTERFAYAGQNNAVFQY 130
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||:|||
  Fly    66 ELRNNVAGGKIEGLPKAVRMAKMSWCEELSHLALLNVKTCESLPDKCRSTERFAYAGQNNALFQY 130

  Fly   131 SGAETEYTDAEIIKEQIENWFAERSNASPEILASFPEELPNKAVTKFTIAVAEKNTHVGCAAVRF 195
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Fly   131 SGAETEYTDAEIIKEQIENWFAERSNASPEILASFPEELPNKAVTKFTIAVAEKNTHVGCAAVRF 195

  Fly   196 SRDFYNHFVLTCNFATSNIVGQPVYTPGEKATTGCKNRYGAAYDYPNLCYAKEIYDNEKVIENTQ 260
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Fly   196 SRDFYNHFVLTCNFATSNIVGQPVYTPGEKATTGCKNRYGAAYDYPNLCYAKEIYDNEKVIENTQ 260

  Fly   261 TM 262
            ||
  Fly   261 TM 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scpr-CNP_001287282.1 SCP_euk 58..210 CDD:240180 150/151 (99%)
scpr-BNP_650061.1 SCP_euk 58..210 CDD:240180 150/151 (99%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440534
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Homologene 1 1.000 - - H77274
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.