DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scpr-C and glipr1b

DIOPT Version :9

Sequence 1:NP_001287282.1 Gene:scpr-C / 41348 FlyBaseID:FBgn0037879 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_005159058.1 Gene:glipr1b / 393547 ZFINID:ZDB-GENE-040426-1459 Length:255 Species:Danio rerio


Alignment Length:186 Identity:33/186 - (17%)
Similarity:59/186 - (31%) Gaps:70/186 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 SWCEELSHLALLNVKTCESLPDKCRSTE----------RFAYAGQN-------------NAVFQY 130
            ||.:||:       |........|:.:.          .|.:.|:|             |||.::
Zfish    67 SWDKELA-------KGARDRARHCKGSHYPSLGHFGHPLFGWMGENIWLGSPFSAFSVENAVHRW 124

  Fly   131 SGAETEYTDAEIIKEQIENWFAERSNASPEILASFPEELPNKAVTKFTIAVAEKNTHVGCAAVRF 195
            |.               |..::.::|....:...:.:.:.:   |.|         .:|||....
Zfish   125 SK---------------EGAYSVKNNNCSRLCGHYAQLMWS---TSF---------KMGCAVNVC 162

  Fly   196 SR---DFYNH---FVLTCNFA-TSNIVGQPVYTPGEKATTGCKNRYGAAYDYPNLC 244
            |:   :|..|   .:..||:. |..:.|...|.  ....:||    |:.....|:|
Zfish   163 SKGIENFSTHPESTIFVCNYGDTGQVHGVTPYM--AMGCSGC----GSEICRDNVC 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scpr-CNP_001287282.1 SCP_euk 58..210 CDD:240180 25/149 (17%)
glipr1bXP_005159058.1 SCP 32..185 CDD:294090 25/151 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.