DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scpr-C and crispld1b

DIOPT Version :9

Sequence 1:NP_001287282.1 Gene:scpr-C / 41348 FlyBaseID:FBgn0037879 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_009296842.1 Gene:crispld1b / 393442 ZFINID:ZDB-GENE-040426-1204 Length:509 Species:Danio rerio


Alignment Length:225 Identity:51/225 - (22%)
Similarity:76/225 - (33%) Gaps:83/225 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 KLILNLFNELRNNVAGGKIEGLPKAVRMAKMSWCEELSHLALLNVKTCESLPDKCRSTERFAYA- 121
            :|||:|.|:||..|       .|.|..|..|.|..||.                 ||.|.:|:. 
Zfish    64 QLILDLHNKLRGQV-------YPPASNMEYMVWDTELE-----------------RSAEHWAHTC 104

  Fly   122 -------------GQNNAVFQYSGAETEYTDAEIIKEQIENWFAE-RSNASPEILASFPEE---- 168
                         |||  :..:.|.:...|      ..::.|:.| |..:.|     :|:|    
Zfish   105 LWEHGPSHLLTRIGQN--LGAHWGRDRPPT------FHVQAWYDEVRDFSYP-----YPQECNPH 156

  Fly   169 ----LPNKAVTKFTIAVAEKNTHVGCAA-VRFSRDFYNHF-----VLTCNFA-TSNIVGQPVYTP 222
                ......|.:|..|...:..:|||. |.::.:.:...     .|.||:: ..|..|...|..
Zfish   157 CPYRCSGPVCTHYTQLVWATSNKIGCAINVCYNMNVWGMIWAKAVYLVCNYSPPGNWWGHAPYKH 221

  Fly   223 GEKATT-------GCKNRYGAAYDYPNLCY 245
            |...:.       ||:|         ||||
Zfish   222 GTPCSACPPSYGGGCRN---------NLCY 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scpr-CNP_001287282.1 SCP_euk 58..210 CDD:240180 40/180 (22%)
crispld1bXP_009296842.1 SCP_euk 64..208 CDD:240180 40/180 (22%)
LCCL 301..385 CDD:128866
LCCL 404..501 CDD:281766
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170585727
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.