DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scpr-C and CG6628

DIOPT Version :9

Sequence 1:NP_001287282.1 Gene:scpr-C / 41348 FlyBaseID:FBgn0037879 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_648386.1 Gene:CG6628 / 39183 FlyBaseID:FBgn0036072 Length:277 Species:Drosophila melanogaster


Alignment Length:239 Identity:94/239 - (39%)
Similarity:128/239 - (53%) Gaps:12/239 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 DYCALPTC--LDKHIACNNKGNFSENCPKDVREVKIEPHHKLILNLFNELRNNVAGGKIEGLPKA 82
            |||....|  |.|||||.|||...:.|..|...|.:.....|||...|.|||.:|.|||..|||.
  Fly    30 DYCQSGLCPSLKKHIACKNKGELGKQCSPDAHLVNLTGLQDLILGEHNALRNVLASGKIINLPKP 94

  Fly    83 VRMAKMSWCEELSHLALLNVKTCESLPDKCRSTERFAYAGQNNAVFQYS--GAETEYTDAEIIKE 145
            .|||.:.|..||:.||.||||.|....|.|.:|..|..:|||.|:...:  ..:..:||..::||
  Fly    95 DRMATLQWHSELADLATLNVKQCVLQHDSCHNTPDFHNSGQNLALVNITLLPEDGNHTDECLVKE 159

  Fly   146 QIENWFAERSNASPEILASFPEELPNKAVTKFTIAVAEKNTHVGCAAVRFSRDFYNH--FVLTCN 208
            .|..|:.:..|.:.|.|..||:.....::..|.:...:.||||||||:||.:. ..|  |:|.||
  Fly   160 SIGGWWNQSINITKEQLQRFPKGKLGDSIRNFAVMARDNNTHVGCAALRFEKP-AGHPLFLLACN 223

  Fly   209 FATSNIVGQPVYTPGEKATTGCKNRYGAAYDYPNLCYAKEIYDN 252
            :|::.:...|:|.  ||| .||::  |:...||:||.|.|.|.:
  Fly   224 YASNYVPDWPIYK--EKA-IGCQS--GSDLKYPSLCKAGEEYQD 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scpr-CNP_001287282.1 SCP_euk 58..210 CDD:240180 62/155 (40%)
CG6628NP_648386.1 SCP_euk 69..225 CDD:240180 62/156 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440538
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 1 0.900 - - E1_COG2340
Homologene 1 1.000 - - H77274
Inparanoid 1 1.050 76 1.000 Inparanoid score I5251
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG26030
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 1 1.000 - - FOG0000453
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
109.910

Return to query results.
Submit another query.