DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scpr-C and CG3640

DIOPT Version :9

Sequence 1:NP_001287282.1 Gene:scpr-C / 41348 FlyBaseID:FBgn0037879 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_611950.1 Gene:CG3640 / 37942 FlyBaseID:FBgn0035042 Length:296 Species:Drosophila melanogaster


Alignment Length:237 Identity:82/237 - (34%)
Similarity:120/237 - (50%) Gaps:15/237 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 DYCA---LPTCLDKHIACNNKGNFSENCPKDVREVKIEPH-HKLILNLFNELRNNVAGGKIEGLP 80
            |||.   .|...| |:||||.|.|..:|.::.|.:.:... ...|::..|..||.||.|.:....
  Fly    25 DYCQEHWCPRSTD-HVACNNNGTFGLDCGREARLIPLSNQLQAFIVHQVNFYRNQVASGGLSAFG 88

  Fly    81 KAVRMAKMSWCEELSHLALLNVKTCESLPDKCRSTERFAYAGQNNAVFQYSGAETEYTDAEIIKE 145
            .|.|||.:.|..||:.||.|..|.|....|.||:|.||.:.||......:|..  :::|.|:::.
  Fly    89 PARRMASVRWDPELAQLAELAAKRCSLSGDGCRNTRRFKHVGQLTGHVIFSAG--KHSDLELLRH 151

  Fly   146 QIENWFAERSNASPEILASFPEELPNKAVTKFTIAVAEKNTHVGCAAVR-FSRDFYNHFVLTCNF 209
            :|.|||.:...||.::.|:.    |:..::.|...:.|.:||:||..:| .|...::...:.|||
  Fly   152 KISNWFGQYMRASKDLQAAD----PSSNISSFRQLIQESSTHMGCGVLRQRSHMLWHQQFIVCNF 212

  Fly   210 ATSNIVGQPVYTPGEKATTGCKNRYGAAYDYPNLCYAKEIYD 251
            |..|:..:.||..| .|.|||  |.|....|||||..:|.||
  Fly   213 ARRNMPREQVYQVG-VAATGC--RSGRNPRYPNLCALQEEYD 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scpr-CNP_001287282.1 SCP_euk 58..210 CDD:240180 48/152 (32%)
CG3640NP_611950.1 SCP_euk 65..213 CDD:240180 48/153 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440594
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 1 0.900 - - E1_COG2340
Homologene 1 1.000 - - H77274
Inparanoid 1 1.050 76 1.000 Inparanoid score I5251
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG26030
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 1 1.000 - - FOG0000453
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
109.910

Return to query results.
Submit another query.