DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scpr-C and CG43775

DIOPT Version :9

Sequence 1:NP_001287282.1 Gene:scpr-C / 41348 FlyBaseID:FBgn0037879 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_726425.3 Gene:CG43775 / 37863 FlyBaseID:FBgn0264297 Length:272 Species:Drosophila melanogaster


Alignment Length:288 Identity:83/288 - (28%)
Similarity:129/288 - (44%) Gaps:58/288 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SLILLTSLLGISL----AADYCALPT-----CLDKHIAC--------NNKGNFSENCPKDVREVK 52
            |::||..||.:.|    ..:||...|     ...||..|        ..:..:..:.| |..:|:
  Fly     3 SILLLAGLLLLLLPMVAGYNYCNNRTHVCDLAQRKHFMCRLGELKPYGGRAKYYASIP-DTLKVR 66

  Fly    53 IEPHHKLILNLFNELRNNVAGGKIE-----GLPKAVRMAKMSWCEELSHLALLNVKTCESLPDKC 112
                 |..|.:.|..|:.:|||:::     ..|.|.||..:.|..||:::|..:..|...:..:|
  Fly    67 -----KDTLAVLNTFRDMLAGGELDTAENKTFPSAKRMRALQWDSELAYMARTHAATVSFMHSEC 126

  Fly   113 RSTERFAYAGQNNAVFQYSGAETEYTDAEIIKEQIENWFAE-RSNASPEILASFPEELPNK---A 173
            |||.||..||:..|:....|.....|  |:::....:.|.| ::...|:   ||.....:|   :
  Fly   127 RSTLRFPLAGEVLALSPPVGHRLSLT--ELLRMVFAHIFDEYKTVQDPQ---SFARRFDSKRDYS 186

  Fly   174 VTKFTIAVAEKNTHVGCA-AV-----RFSRDFYNHFVLTCNFATSNIVGQPVYTPGEKATTGCKN 232
            |..|:|.|.::.:.|||. ||     :..:..:.|| |||:|..:|:.|..||..| ||||||.:
  Fly   187 VGHFSIIVNDRVSRVGCGFAVGSNCEKDGKVGFCHF-LTCHFDYTNVNGSYVYKTG-KATTGCND 249

  Fly   233 -RYGAAYDYPNLCYAKEIYDNEKVIENT 259
             :..|:..|.|||            |||
  Fly   250 WKTIASIKYSNLC------------ENT 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scpr-CNP_001287282.1 SCP_euk 58..210 CDD:240180 48/166 (29%)
CG43775NP_726425.3 SCP_euk 66..228 CDD:240180 48/172 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440648
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.